Structure of PDB 1vfc Chain A Binding Site BS01

Receptor Information
>1vfc Chain A (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMI
KDRWRTMKRLGMN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vfc Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
ResolutionN/A
Binding residue
(original residue number in PDB)		K446 K447 G468 W470 A471 K488 D489 R492
Binding residue
(residue number reindexed from 1)		K9 K10 G31 W33 A34 K51 D52 R55
Binding affinityPDBbind-CN: Kd=0.75uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vfc, PDBe:1vfc, PDBj:1vfc
PDBsum1vfc
PubMed15608118
UniProtQ15554|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]