Structure of PDB 1tce Chain A Binding Site BS01

Receptor Information
>1tce Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGSQSGQ
PKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPV
ERKLLEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tce Solution structure of the Shc SH2 domain complexed with a tyrosine-phosphorylated peptide from the T-cell receptor.
ResolutionN/A
Binding residue
(original residue number in PDB)
R16 R32 H53 L54 L55 L56 D58 R64 T65 I87 S89 A90
Binding residue
(residue number reindexed from 1)
R16 R32 H53 L54 L55 L56 D58 R64 T65 I87 S89 A90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tce, PDBe:1tce, PDBj:1tce
PDBsum1tce
PubMed7544002
UniProtP29353|SHC1_HUMAN SHC-transforming protein 1 (Gene Name=SHC1)

[Back to BioLiP]