Structure of PDB 1s9v Chain A Binding Site BS01

Receptor Information

>1s9v Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQ
FRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQ
PNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYL
TLLPSAEESYDCKVEHWGLDKPLLKHWEP

Ligand information

>1s9v Chain C (length=11) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LQPFPQPELPY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1s9v Structural basis for HLA-DQ2-mediated presentation of gluten epitopes in celiac disease
Resolution	2.22 Å
Binding residue (original residue number in PDB)	F51 R52 F54 F58 N62 V65 L66 N69
Binding residue (residue number reindexed from 1)	F51 R52 F53 F57 N61 V64 L65 N68

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1s9v, PDBe:1s9v, PDBj:1s9v
PDBsum	1s9v
PubMed	15020763
UniProt	P01909\|DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain (Gene Name=HLA-DQA1)

[Back to BioLiP]