Structure of PDB 1loc Chain A Binding Site BS01

Receptor Information

>1loc Chain A (length=180) Species: 3858 (Lathyrus ochrus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPI
HIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGY
LGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTK
SWALQNGKEANVVIAFNAATNVLTVSLTYP

Ligand information

>1loc Chain 1 (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gAE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1loc Interaction of a legume lectin with two components of the bacterial cell wall. A crystallographic study.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	A80 D81 G97 G99 Y100 F123 N125
Binding residue (residue number reindexed from 1)	A80 D81 G97 G99 Y100 F123 N125

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005537	D-mannose binding
GO:0030246	carbohydrate binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:1loc, PDBe:1loc, PDBj:1loc
PDBsum	1loc
PubMed	8144527
UniProt	P04122\|LECB_LATOC Lectin beta-1 and beta-2 chains

[Back to BioLiP]