Structure of PDB 1kyd Chain A Binding Site BS01

Receptor Information
>1kyd Chain A (length=247) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFY
GNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIEC
ISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWK
QLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAG
IIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kyd Accessory protein recruitment motifs in clathrin-mediated endocytosis.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F837 W840 K841 D881 P882 R905
Binding residue
(residue number reindexed from 1)
F146 W149 K150 D190 P191 R214
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1kyd, PDBe:1kyd, PDBj:1kyd
PDBsum1kyd
PubMed12057195
UniProtP17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 (Gene Name=Ap2a2)

[Back to BioLiP]