Structure of PDB 1jgn Chain A Binding Site BS01

Receptor Information
>1jgn Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEI
DNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
Ligand information
>1jgn Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VVKSNLNPNAKEFVPGVKYGNI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jgn Structural basis of ligand recognition by PABC, a highly specific peptide-binding domain found in poly(A)-binding protein and a HECT ubiquitin ligase
ResolutionN/A
Binding residue
(original residue number in PDB)		K21 Q22 E26 K42 G45 M46 L47 L48 E49 K68 E71
Binding residue
(residue number reindexed from 1)		K21 Q22 E26 K42 G45 M46 L47 L48 E49 K68 E71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1jgn, PDBe:1jgn, PDBj:1jgn
PDBsum1jgn
PubMed14685257
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]