Structure of PDB 1i51 Chain A Binding Site BS01

Receptor Information
>1i51 Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFD
VIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVT
PIKDLTAHFRGARCKTLLEKPKLFFIQACRGTELDDGIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i51 Structural basis of caspase-7 inhibition by XIAP.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
M84 H144 T189
Binding residue
(residue number reindexed from 1)
M27 H87 T132
Enzymatic activity
Catalytic site (original residue number in PDB) G85 V86 H144 G145 C186
Catalytic site (residue number reindexed from 1) G28 V29 H87 G88 C129
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1i51, PDBe:1i51, PDBj:1i51
PDBsum1i51
PubMed11257230
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]