BioLiP

Structure of PDB 1h6f Chain A Binding Site BS01

Receptor Information

>1h6f Chain A (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYIL
LMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKV
VTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTY
LFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD

Ligand information

>1h6f Chain C (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

taatttcacacctaggtgtgaaat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1h6f Structure of the DNA-Bound T-Box Domain of Human Tbx3, a Transcription Factor Responsible for Ulnar- Mammary Syndrome
Resolution	1.7 Å
Binding residue (original residue number in PDB)	N211 S224 T262 P278 F279 K281
Binding residue (residue number reindexed from 1)	N110 S123 T161 P177 F178 K180

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:1h6f, PDBe:1h6f, PDBj:1h6f
PDBsum	1h6f
PubMed	12005433
UniProt	O15119\|TBX3_HUMAN T-box transcription factor TBX3 (Gene Name=TBX3)