Structure of PDB 1h6f Chain A Binding Site BS01

Receptor Information
>1h6f Chain A (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYIL
LMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKV
VTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTY
LFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h6f Structure of the DNA-Bound T-Box Domain of Human Tbx3, a Transcription Factor Responsible for Ulnar- Mammary Syndrome
Resolution1.7 Å
Binding residue
(original residue number in PDB)		N211 S224 T262 P278 F279 K281
Binding residue
(residue number reindexed from 1)		N110 S123 T161 P177 F178 K180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h6f, PDBe:1h6f, PDBj:1h6f
PDBsum1h6f
PubMed12005433
UniProtO15119|TBX3_HUMAN T-box transcription factor TBX3 (Gene Name=TBX3)

[Back to BioLiP]