BioLiP

Structure of PDB 1h0m Chain A Binding Site BS01

Receptor Information

>1h0m Chain A (length=230) Species: 358 (Agrobacterium tumefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQHWLDKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAV
TNYHRQWQSTYFDKKFEALDPVVKRARSRKHIFTWSGEHERPTLSKDERA
FYDHASDFGIRSGITIPIKTANGFMSMFTMASDKPVIDLDREIDAVAAAA
TIGQIHARISFLRTTDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNS
VRVKLREAMKRFDVRSKAHLTALAIRRKLI

Ligand information

>1h0m Chain E (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgtgcagatctgcacat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1h0m The Crystal Structure of the Quorum Sensing Protein Trar Bound to its Autoinducer and Target DNA
Resolution	3.0 Å
Binding residue (original residue number in PDB)	M213 R219 S220 K221
Binding residue (residue number reindexed from 1)	M209 R215 S216 K217

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0001216	DNA-binding transcription activator activity
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0009372	quorum sensing
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:1h0m, PDBe:1h0m, PDBj:1h0m
PDBsum	1h0m
PubMed	12198141
UniProt	P33905\|TRAR_RHIRD Transcriptional activator protein TraR (Gene Name=traR)