Structure of PDB 1f8h Chain A Binding Site BS01

Receptor Information
>1f8h Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWE
LSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f8h Molecular mechanism of NPF recognition by EH domains.
ResolutionN/A
Binding residue
(original residue number in PDB)		K37 L40 V47 L50 G51 W54
Binding residue
(residue number reindexed from 1)		K32 L35 V42 L45 G46 W49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1f8h, PDBe:1f8h, PDBj:1f8h
PDBsum1f8h
PubMed11062555
UniProtP42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 (Gene Name=EPS15)

[Back to BioLiP]