Structure of PDB 1ebp Chain A Binding Site BS01

Receptor Information
>1ebp Chain A (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQL
EDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRY
HRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVD
VSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFW
SAWSEPVSLLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ebp Functional mimicry of a protein hormone by a peptide agonist: the EPO receptor complex at 2.8 A.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		P149 M150 T151 S152 H153 F205
Binding residue
(residue number reindexed from 1)		P140 M141 T142 S143 H144 F196
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004896 cytokine receptor activity
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ebp, PDBe:1ebp, PDBj:1ebp
PDBsum1ebp
PubMed8662530
UniProtP19235|EPOR_HUMAN Erythropoietin receptor (Gene Name=EPOR)

[Back to BioLiP]