Structure of PDB 1e91 Chain A Binding Site BS01

Receptor Information
>1e91 Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPF
RGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1e91 The MAD1-Sin3B Interaction Involves a Novel Helical Fold
ResolutionN/A
Binding residue
(original residue number in PDB)		A10 I11 Y13 V14 N15 L35 Q39 F76 F79
Binding residue
(residue number reindexed from 1)		A10 I11 Y13 V14 N15 L35 Q39 F76 F79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1e91, PDBe:1e91, PDBj:1e91
PDBsum1e91
PubMed11101889
UniProtQ62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b (Gene Name=Sin3b)

[Back to BioLiP]