Structure of PDB 1e6i Chain A Binding Site BS01

Receptor Information
>1e6i Chain A (length=110) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGPHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTME
IKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKV
KEIPEYSHLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1e6i The Structural Basis for the Recognition of Acetylated Histone H4 by the Bromodomain of Histone Acetyltransferase Gcn5P
Resolution1.87 Å
Binding residue
(original residue number in PDB)		V356 F367 R404 Y406 N407 G408 Y413 I438
Binding residue
(residue number reindexed from 1)		V28 F39 R76 Y78 N79 G80 Y85 I110
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:1e6i, PDBe:1e6i, PDBj:1e6i
PDBsum1e6i
PubMed11080160
UniProtQ03330|GCN5_YEAST Histone acetyltransferase GCN5 (Gene Name=GCN5)

[Back to BioLiP]