BioLiP

Structure of PDB 1bcs Chain A Binding Site BS01

Receptor Information

>1bcs Chain A (length=255) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HAADRIARLPGQPAVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPL
VLWLNGGPGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLD
SPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAKWFERFPHYKYRDFYIA
GESYAGHYVPELSQLVHRSKNPVINLKGFMVGNGLIDDYHDYVGTFEFWW
NHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQGNIDMYSLYT
PVCNI

Ligand information

>1bcs Chain C (length=4) Species: 1912 (Streptomyces hygroscopicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FLLF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1bcs Peptide aldehyde complexes with wheat serine carboxypeptidase II: implications for the catalytic mechanism and substrate specificity.
Resolution	2.08 Å
Binding residue (original residue number in PDB)	G52 G53 C56 S146 Y147 F215 Y239
Binding residue (residue number reindexed from 1)	G56 G57 C60 S153 Y154 F222 Y246

Enzymatic activity

Catalytic site (original residue number in PDB)	G53 S146 Y147
Catalytic site (residue number reindexed from 1)	G57 S153 Y154
Enzyme Commision number	3.4.16.6: carboxypeptidase D.

Gene Ontology

	Molecular Function
GO:0004185	serine-type carboxypeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:1bcs, PDBe:1bcs, PDBj:1bcs
PDBsum	1bcs
PubMed	8636973
UniProt	P08819\|CBP2_WHEAT Serine carboxypeptidase 2 (Gene Name=CBP2)