Structure of PDB 1au1 Chain A Binding Site BS01

Receptor Information
>1au1 Chain A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF
QKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKT
VLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEI
LRNFYFINRLTGYLRN
Ligand information
Ligand IDBGC
InChIInChI=1S/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5-,6-/m1/s1
InChIKeyWQZGKKKJIJFFOK-VFUOTHLCSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6C(C1C(C(C(C(O1)O)O)O)O)O
CACTVS 3.370OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O
CACTVS 3.370OC[CH]1O[CH](O)[CH](O)[CH](O)[CH]1O
OpenEye OEToolkits 1.7.6C([C@@H]1[C@H]([C@@H]([C@H]([C@@H](O1)O)O)O)O)O
ACDLabs 12.01OC1C(O)C(OC(O)C1O)CO
FormulaC6 H12 O6
Namebeta-D-glucopyranose;
beta-D-glucose;
D-glucose;
glucose
ChEMBLCHEMBL1614854
DrugBankDB02379
ZINCZINC000003833800
PDB chain1au1 Chain C Residue 1 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1au1 The crystal structure of human interferon beta at 2.2-A resolution.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N80 T82
Binding residue
(residue number reindexed from 1)		N80 T82
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005126 cytokine receptor binding
GO:0005132 type I interferon receptor binding
GO:0005515 protein binding
GO:0008811 chloramphenicol O-acetyltransferase activity
Biological Process
GO:0002250 adaptive immune response
GO:0002286 T cell activation involved in immune response
GO:0002312 B cell activation involved in immune response
GO:0002323 natural killer cell activation involved in immune response
GO:0006952 defense response
GO:0006959 humoral immune response
GO:0007166 cell surface receptor signaling pathway
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0009615 response to virus
GO:0010508 positive regulation of autophagy
GO:0019221 cytokine-mediated signaling pathway
GO:0030101 natural killer cell activation
GO:0030183 B cell differentiation
GO:0033141 positive regulation of peptidyl-serine phosphorylation of STAT protein
GO:0035458 cellular response to interferon-beta
GO:0042100 B cell proliferation
GO:0043330 response to exogenous dsRNA
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0045089 positive regulation of innate immune response
GO:0045343 regulation of MHC class I biosynthetic process
GO:0045581 negative regulation of T cell differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051607 defense response to virus
GO:0060337 type I interferon-mediated signaling pathway
GO:0070050 neuron cellular homeostasis
GO:0071360 cellular response to exogenous dsRNA
GO:0098586 cellular response to virus
GO:0140123 negative regulation of Lewy body formation
GO:2000552 negative regulation of T-helper 2 cell cytokine production
GO:2001235 positive regulation of apoptotic signaling pathway
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1au1, PDBe:1au1, PDBj:1au1
PDBsum1au1
PubMed9342320
UniProtP01574|IFNB_HUMAN Interferon beta (Gene Name=IFNB1)

[Back to BioLiP]