Structure of PDB 1a1c Chain A Binding Site BS01

Receptor Information
>1a1c Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDF
DNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL
TTVCP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1c Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
R158 R178 S180 T182 H204 Y205 K206 T218 G239
Binding residue
(residue number reindexed from 1)
R14 R34 S36 T38 H60 Y61 K62 T74 G95
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1a1c, PDBe:1a1c, PDBj:1a1c
PDBsum1a1c
PubMed9174343
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]