Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Probable G-protein coupled receptor 174
Species	Homo sapiens (Human)
Gene	GPR174
Synonym	FKSG79 GPR174
Disease	N/A
Length	333
Amino acid sequence	MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFRRRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC
UniProt	Q9BXC1
Protein Data Bank	N/A
GPCR-HGmod model	Q9BXC1
3D structure model	This predicted structure model is from GPCR-EXP Q9BXC1.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3562167
IUPHAR	145
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
557916	CHEMBL81113	C21H26N2O5S	418.508	6 / 2	2.8	Yes
468169	CHEMBL3577163	C23H44NO9P	509.577	10 / 4	1.5	No
469560	CHEMBL3577155	C24H48NO8P	509.621	9 / 4	2.5	No
469613	CHEMBL3577149	C22H42NO8P	479.551	9 / 3	2.0	Yes
471762	CHEMBL3577142	C24H45FNO8P	525.595	10 / 3	3.2	No
471765	CHEMBL3577141	C24H45FNO8P	525.595	10 / 3	3.2	No
472222	CHEMBL3577180	C26H44NO9P	545.61	10 / 3	2.5	No
473007	CHEMBL3577177	C22H36NO9P	489.502	10 / 3	0.4	Yes
474593	CHEMBL3577263	C27H46NO10P	575.636	11 / 4	2.0	No
475155	CHEMBL3577156	C24H47N2O8P	522.62	9 / 5	1.6	No
476067	CHEMBL3577168	C22H36NO10P	505.501	11 / 4	-0.6	No
476222	CHEMBL3577172	C26H44NO10P	561.609	11 / 4	1.6	No
476771	CHEMBL3577164	C23H46NO9P	511.593	10 / 4	2.4	No
478844	CHEMBL3577176	C30H52NO10P	617.717	11 / 4	3.7	No
479995	CHEMBL3577165	C21H42NO9P	483.539	10 / 4	1.3	Yes
480368	CHEMBL3577264	C23H38NO10P	519.528	11 / 4	-0.2	No
482813	CHEMBL3577262	C26H42F2NO9P	581.591	12 / 3	2.9	No
482846	CHEMBL3577166	C19H38NO9P	455.485	10 / 4	0.3	Yes
483140	CHEMBL3577138	C24H46NO9P	523.604	10 / 4	2.1	No
483144	CHEBI:52649	C24H46NO9P	523.604	10 / 4	2.1	No
487039	CHEMBL3577181	C26H44NO9P	545.61	10 / 3	2.5	No
492359	CHEMBL3577147	C18H36NO9P	441.458	10 / 4	-0.2	Yes
494195	CHEMBL3577178	C24H40NO9P	517.556	10 / 3	1.5	No
494806	CHEMBL3577167	C22H36NO10P	505.501	11 / 4	-0.6	No
495877	CHEMBL3577151	C20H40NO8P	453.513	9 / 3	1.9	Yes
497225	CHEMBL3577174	C30H52NO10P	617.717	11 / 4	3.7	No
497285	CHEMBL3577169	C22H36NO10P	505.501	11 / 4	-0.6	No
498514	CHEMBL3577158	C25H48NO9P	537.631	10 / 3	2.5	No
499692	CHEMBL3577182	C26H43FNO9P	563.6	11 / 3	2.6	No
500832	CHEMBL3577173	C26H44NO10P	561.609	11 / 4	1.6	No
566921	CHEMBL422227	C22H16FN3O	357.388	4 / 0	3.7	Yes
501188	CHEMBL3577170	C24H40NO10P	533.555	11 / 4	0.5	No
567011	D0M2RI	C36H58N6O14S	830.948	15 / 11	1.4	No
501877	CHEMBL3577150	C22H44NO8P	481.567	9 / 3	3.0	Yes
503382	CHEMBL3577162	C25H48NO9P	537.631	10 / 4	2.6	No
504462	CHEMBL3577171	C26H44NO10P	561.609	11 / 4	1.6	No
509777	CHEMBL3577175	C30H52NO10P	617.717	11 / 4	3.7	No
511418	CHEMBL3577145	C22H44NO9P	497.566	10 / 4	2.0	Yes
511638	CHEMBL3577148	C16H32NO9P	413.404	10 / 4	-1.3	Yes
512213	CHEMBL3577144	C22H42NO9P	495.55	10 / 4	1.1	Yes
513051	CHEMBL3577179	C26H44NO9P	545.61	10 / 3	2.5	No
515908	CHEMBL3577146	C20H40NO9P	469.512	10 / 4	0.9	Yes
515973	CHEMBL3577265	C27H47N2O9P	574.652	10 / 5	1.4	No
555447	lysophosphatidylserine	C24H48NO9P	525.62	10 / 4	3.1	No

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417