Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	2-oxoglutarate receptor 1
Species	Homo sapiens (Human)
Gene	OXGR1
Synonym	Alpha-ketoglutarate receptor 1 P2Y15 P2Y-like nucleotide receptor P2Y-like GPCR P2Y purinoceptor 15 P2RY15 oxoglutarate receptor GPR99 G-protein coupled receptor 99 G-protein coupled receptor 80 G protein-coupled receptor 99 G protein-coupled receptor 80 2-oxoglutarate receptor 1 GPR80 [ Show all ]
Disease	N/A
Length	337
Amino acid sequence	MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
UniProt	Q96P68
Protein Data Bank	N/A
GPCR-HGmod model	Q96P68
3D structure model	This predicted structure model is from GPCR-EXP Q96P68.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL2150840
IUPHAR	162
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
12675	CHEMBL2153586	C25H19ClN4O	426.904	5 / 0	5.8	No
131168	CHEMBL2153596	C21H16ClF3N4O	432.831	8 / 0	5.5	No
554161	2-ketoglutaric acid	C5H6O5	146.098	5 / 2	-0.9	Yes
265460	CHEMBL2153439	C26H25N3O	395.506	3 / 1	4.8	Yes
310813	CHEMBL2153595	C21H16ClF3N4O2	448.83	9 / 0	5.8	No
322243	CHEMBL2153461	C31H23F4N3O	529.539	7 / 1	6.8	No
324371	CHEMBL2153446	C26H24ClN3O	429.948	3 / 1	5.5	No
324964	CHEMBL2153581	C23H18F4N4O2	458.417	9 / 1	4.0	Yes
379903	CHEMBL2153440	C25H22ClN3O	415.921	3 / 1	5.1	No

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417