GPCR Sequence:

>sp|Q9NZH0|GPC5B_HUMAN G-protein coupled receptor family C group 5 member B OS=Homo sapiens GN=GPRC5B PE=2 SV=2
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE
AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDET
ICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEW
LVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITA
FLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL
QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPS
GSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW

Estimation of the GPCR-I-TASSER model for Q9NZH0

C-score = -4.140
TM-score = 0.270 (estimated)
RMSD = 17.4 A (estimated)

Here, C-score is a confidence score of the GPCR-I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of GPCR-I-TASSER simulations.

The top ten threading templates used by GPCR-I-TASSER

Rank	PDB ID	Z-score	Download Templates
1	3ck7A	1.699	template1
2	2ks9A	1.008	template2
3	2e4u_A	2.682	template3
4	1pf4a	1.056	template4
5	3a0oA3	1.632	template5
6	2z73_A	1.251	template6
7	3cghA	1.628	template7
8	3lewA	1.589	template8
9	3ehmA	1.578	template9
10	2vn4A	0.807	template10
(a) Rank of templates represents the top ten threading templates used by GPCR-I-TASSER. (b) Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa. (c) Download Templates provides the 3D structure of the aligned regions of the threading templates.

Reference:

J Zhang, J Yang, R Jang, Y Zhang, Novel hybrid approach to G protein-coupled receptor structure modeling and case study on human genome, submitted, 2014.

Back to the GPCR-I-TASSER model page