GPCR-I-TASSER model for Q8NGR2
(OR1L6_HUMAN Olfactory receptor 1L6 OS=Homo sapiens GN=OR1L6 PE=2 SV=2)


Click to download model1.pdb

GPCR Sequence:

    >sp|Q8NGR2|OR1L6_HUMAN Olfactory receptor 1L6 OS=Homo sapiens GN=OR1L6 PE=2 SV=2
    MSYFYRLKLMKEAVLVKLPFTSLPLLLQTLSRKSRDMEIKNYSSSTSGFILLGLSSNPQL
    QKPLFAIFLIMYLLAAVGNVLIIPAIYSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLV
    NFLSETKVISYVGCLAQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPRHCLL
    MLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTET
    LAVIVTPFLCIIFSYLRIMVTVLRIPSAAGKWKAFSTCGSHLTAVALFYGSIIYVYFRPL
    SMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLQDRIYR

Estimation of the GPCR-I-TASSER model for Q8NGR2

    C-score = -0.830
    TM-score = 0.610 (estimated)
    RMSD = 8.4 A (estimated)

    Here, C-score is a confidence score of the GPCR-I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of GPCR-I-TASSER simulations.

The top ten threading templates used by GPCR-I-TASSER

Reference:

    J Zhang, J Yang, R Jang, Y Zhang, Novel hybrid approach to G protein-coupled receptor structure modeling and case study on human genome, submitted, 2014.


Back to the GPCR-I-TASSER model page

 


zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue Ann Arbor, MI 48109-2218