GPCR Sequence:

>sp|O14626|GP171_HUMAN Probable G-protein coupled receptor 171 OS=Homo sapiens GN=GPR171 PE=2 SV=1
MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTAD
FLLTLALPVKIVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSC
KIYRIQEPGFAKMISTVVWLMVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLT
NFICVAIFLNFSAIILISNCLVIRQLYRNKDNENYPNVKKALINILLVTTGYIICFVPYH
IVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRSKVTETF
ASPKETKAQKEKLRCENNA

Estimation of the GPCR-I-TASSER model for O14626

C-score = 1.010
TM-score = 0.850 (estimated)
RMSD = 4.2 A (estimated)

Here, C-score is a confidence score of the GPCR-I-TASSER predictions which is typically in [-5,2]. TM-score and RMSD measure how close the model is to the native structure and both are estimated based on the C-score. TM-score is in [0,1] with a value >0.5 implying the model of correct topology. The TM-score and RMSD estimations are made only for the first model because absolute values of TM-score and RMSD for the lower-rank models do not strongly correlate with the C-score. The models are ranked based on the structure density of GPCR-I-TASSER simulations.

The top ten threading templates used by GPCR-I-TASSER

Rank	PDB ID	Z-score	Download Templates
1	2ks9A	2.775	template1
2	2rh1_A	6.173	template2
3	3odua	4.170	template3
4	2ks9a	6.171	template4
5	1l9ha	3.858	template5
6	2ks9A	5.661	template6
7	2rh1_A	5.443	template7
8	hs1u19	2.857	template8
9	2ks9a	5.993	template9
10	3pblA1	2.717	template10
(a) Rank of templates represents the top ten threading templates used by GPCR-I-TASSER. (b) Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa. (c) Download Templates provides the 3D structure of the aligned regions of the threading templates.

Reference:

J Zhang, J Yang, R Jang, Y Zhang, Novel hybrid approach to G protein-coupled receptor structure modeling and case study on human genome, submitted, 2014.

Back to the GPCR-I-TASSER model page