Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	P2Y purinoceptor 13
Species	Homo sapiens (Human)
Gene	P2RY13
Synonym	G-protein coupled receptor 86 purinergic receptor P2Y, G-protein coupled 13 purinergic receptor P2Y P2Y13 receptor P2Y13 G protein-coupled receptor 86 GPR94 G-protein coupled receptor 94 P2Y purinoceptor 13 [ Show all ]
Disease	N/A
Length	354
Amino acid sequence	MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
UniProt	Q9BPV8
Protein Data Bank	N/A
GPCR-HGmod model	Q9BPV8
3D structure model	This predicted structure model is from GPCR-EXP Q9BPV8.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	N/A
IUPHAR	329
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
553662	suramin	C51H40N6O23S6	1297.26	23 / 12	1.5	No
553805	Adpbetas	C10H15N5O9P2S	443.264	14 / 6	-2.9	No
554070	Affi gel blue	C29H20ClN7O11S3	774.147	18 / 7	4.4	No
554401	ATPgammaS	C10H12N5O12P3S-4	519.21	17 / 3	-4.3	No
554530	Cangrelor	C17H25Cl2F3N5O12P3S2	776.346	21 / 7	-1.0	No
555165	[33P]2-methylthio-ADP	C11H17N5O10P2S	477.285	15 / 6	-3.8	No
555166	2-MeSADP	C11H17N5O10P2S	473.29	15 / 6	-3.8	No
555267	2-Mesatp	C11H18N5O13P3S	553.268	18 / 7	-4.9	No
555280	Adenosine 5'-diphosphate	C10H15N5O10P2	427.203	14 / 6	-4.6	No
555283	Poly(2'-methylthioadenylic acid)	C11H16N5O7PS	393.311	12 / 5	-2.7	No
555350	Ap4A	C20H24N10O19P4-4	832.358	27 / 6	-8.6	No
555425	Adenosine triphosphate	C10H16N5O13P3	507.181	17 / 7	-5.7	No

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417