Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	B1 bradykinin receptor
Species	Mus musculus (Mouse)
Gene	Bdkrb1
Synonym	bradykinin receptor BKR1 BK-1 receptor B1R B1BKR B1 receptor kinin B1 receptor [ Show all ]
Disease	N/A for non-human GPCRs
Length	334
Amino acid sequence	MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL
UniProt	Q61125
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL1250407
IUPHAR	41
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
553276	des-Arg10-Kallidin	C50H73N13O11	1032.21	14 / 11	-3.8	No
9247	Safotibant	C25H34N4O5S	502.63	7 / 1	1.6	No
553348	8-Leu-9-des-arg-BK	C41H63N11O10	870.022	12 / 9	-3.6	No
25112	CHEMBL2087036	C23H26Cl2N4O3S	509.446	5 / 1	2.9	No
66708	CHEMBL2087410	C24H32N4O5S	488.603	7 / 1	1.2	Yes
553710	KALLIDIN	C56H85N17O12	1188.4	16 / 14	-5.3	No
138380	CHEMBL2087035	C23H28Cl2N4O4S	527.461	6 / 1	2.5	No
171709	CHEMBL2087414	C23H27N5O4S	469.56	7 / 1	0.6	Yes
197592	CHEMBL2087034	C22H26Cl2N4O3S	497.435	5 / 1	2.6	Yes
205578	CHEMBL2087033	C23H28Cl2N4O3S	511.462	5 / 1	2.9	No
236238	CHEMBL2087413	C23H29ClN4O5S	509.018	7 / 1	1.5	No
262605	CHEMBL2087436	C23H27Cl2N5O4S	540.46	6 / 2	2.0	No
554713	BRADYKININ	C50H73N15O11	1060.23	14 / 12	-4.8	No
302463	SCHEMBL4031279	C24H30Cl2N4O3S	525.489	5 / 1	3.3	No
555046	[des-Arg9]BK	C44H61N11O10	904.039	12 / 9	-3.3	No
394089	CHEMBL2087416	C22H26F2N4O4S	480.531	8 / 1	1.1	Yes
413502	CHEMBL2087412	C22H26Cl2N4O4S	513.434	6 / 1	2.2	No
439947	CHEMBL2087411	C22H26Cl2N4O4S	513.434	6 / 1	2.2	No

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417