Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	cinnarizine
Molecular formula	C26H28N2
IUPAC name	1-benzhydryl-4-[(E)-3-phenylprop-2-enyl]piperazine
Molecular weight	368.524
Hydrogen bond acceptor	2
Hydrogen bond donor	0
XlogP	5.8
Synonyms	1-trans-Cinnamyl-4-diphenylmethylpiperazine Giganten 298-57-7 HMS3712H18 AC1LU5GC Labyrin Artate MFCD00056037 C26H28N2 N-Benzhydryl-N'-cinnamylpiperazine CHEBI:31403 NCGC00021488-03 Cinazyn Piperazine, (E)- Cinnarizine, powder D01295 1-Benzhydryl-4-cinnamylpiperazin DSSTox_GSID_22821 SR-01000003093-2 Stunarone UNII-3DI2E1X18L R 1575 SCHEMBL44958 EBD32904 1412-EP2280008A2 Hilactan 4-((2E)-3-phenylprop-2-enyl)-1-(diphenylmethyl)piperazine Ixertol AOB5321 Lopac0_000314 BRD-K07220430-001-03-6 MLS000028498 CCG-204409 NCGC00018187-04 cid_1547484 NCGC00260999-01 Prestwick2_000278 Cinnarizinum 1-(diphenylmethyl)-4-(3-phenyl-2-propenyl)-piperazine Denapol 1-benzhydryl-4-[(E)-3-phenylprop-2-enyl]piperazine STK216257 Stutgin W-110442 R-516 Sepan 1-Cinnamyl-4-(diphenylmethyl)piperazine EU-0100314 1412-EP2305219A1 HMS2234B20 7002-58-6 (di-hydrochloride) KS-5155 Apotomin Marisan BSPBio_000156 MLS002222167 Cero-Aterin NCGC00018187-07 Cinarizina [INN-Spanish] Olamin Cinnarizine [USAN:INN:BAN:JAN] Corathiem 1-(diphenylmethyl)-4-[(2E)-3-phenylprop-2-en-1-yl]piperazine Dimitronal Spaderizine Stugeron (TN) Tox21_110109_1 Processine SC-14096 DSSTox_RID_76744 1-[di(phenyl)methyl]-4-(3-phenylprop-2-enyl)piperazine Glanil 298C577 HY-B1090 AKOS002134299 Lazeta BDBM50017657 Midronal Carecin NCGC00015246-02 NCGC00021488-04 Cinnacet Piperazine, 1-(diphenylmethyl)-4-(3-phenyl-2-propenyl)- Cinnarizine-d8 (E)-1-Benzhydryl-4-cinnamylpiperazine D0Q3YO 1-Benzhydryl-4-cinnamylpiperazine SR-01000003093-6 Stunarone (TN) Votegol R 516 Sedatromin Eglen 1412-EP2298764A1 HMS1568H18 J10228 Aplactan LP00314 BRD-K74927006-001-01-2 MLS001148649 Cerebolan NCGC00018187-05 Cinaperazine NSC-290687 Cinnarizine (JAN/USAN/INN) Cinnarizinum [INN-Latin] 1-(Diphenylmethyl)-4-(3-phenyl-2-propenyl)piperazine DERZBLKQOCDDDZ-JLHYYAGUSA-N 1-benzhydryl-4-[(E)-cinnamyl]piperazine Siptazin Stonoron Toliman Zepamol Prestwick3_000278 S4727 1-Cinnamyl-4-diphenylmethylpiperazine Folcodal 16699-20-0 HMS3260P10 A820077 L001227 ARONIS27007 MD 516 C 5270 MolPort-002-056-760 CHEBI:131176 NCGC00018187-09 Cinarizine Opera_ID_1776 Cinnarizine, European Pharmacopoeia (EP) Reference Standard CS-4656 1-(diphenylmethyl)-4-[(E)-3-phenylprop-2-enyl]piperazine DSSTox_CID_2821 SR-01000003093 Stugeron\|Dimitronal\|Stutgin\|Cinarizine Tox21_500314 QTL1_000023 SCHEMBL44957 DTXSID3022821 1412-EP2275420A1 GTPL9072 3DI2E1X18L I01-3582 AN-25314 Libotasin BPBio1_000172 Mitronal CAS-298-57-7 NCGC00018187-03 CHEMBL43064 NCGC00021488-05 Cinnageron Piperazine, 1-cinnamyl-4-(diphenylmethyl)- Cinnarizine; 1-(Diphenylmethyl)-4-(3-phenyl-2-propenyl)-piperazine 1-(Diphenylmethyl)-4-(3-phenyl-2-propen-1-yl)piperazine 1-benzhydryl-4-[(2E)-3-phenylprop-2-enyl]piperazine ST069378 Stutgeron W-106970 R-1575 Senoger 1-Benzhydryl-4-[3-phenyl-2-propenyl]piperazine # EINECS 206-064-8 1412-EP2298765A1 HMS2095H18 516 MD Katoseran Aplexal LS-111394 BRN 0626121 MLS002207295 Cerepar NCGC00018187-06 Cinarizina NSC290687 Cinnarizine Stugeron component of Emesazine (Salt/Mix) 1-(diphenylmethyl)-4-(3-phenylprop-2-en-1-yl)piperazine Dimitron SMR000058307 Stugeron Tox21_110109 ZINC19632891 Prestwick_115 SBB057016 [ Show all ]
Inchi Key	DERZBLKQOCDDDZ-JLHYYAGUSA-N
Inchi ID	InChI=1S/C26H28N2/c1-4-11-23(12-5-1)13-10-18-27-19-21-28(22-20-27)26(24-14-6-2-7-15-24)25-16-8-3-9-17-25/h1-17,26H,18-22H2/b13-10+
PubChem CID	1547484
ChEMBL	CHEMBL43064
IUPHAR	N/A
BindingDB	50017657
DrugBank	DB00568
Structure SDF download
Lipinski's druglikeness	This ligand has a partition coefficient log P greater than 5.

Experimental Data

Parameter	Value	Reference	Database source
	N/A	N/A	DrugBank
IC50	776.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL
Ki	259.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417