[back]

COFACTOR result for job id 76685

[Download result.tar.bz2 for all prediction results]

User Input

>76685 (371 residues)
MISVDQELFPINQRLNKEVVFDKVLDELNHPEEFLKVINVVGTNGKGSTSFYLSKGLLKK
YQKVGLFISPAFLYQNERIQINNTPISDNDLKSYLHKIDYLIKKYQLLFFEIWTLIMILY
FKDQKVDIVVCEAGIGGIKDTTSFLTNQLFSLCTSISYDHMDILGNSIDEIIYNKINIAK
PNTKLFISYDNLKYKDKINEQLINKNVELIYTDLYEDQIIYQQANKGLVKKVLEYLNIFQ
TNIFQLQPPLGRFTTIRTFPNHIIIDGAHNVDGINKLIQSVKMLNKEFIVLYASITTKEY
LKSLELLDQNFNEVYICEFNFIKSWSIDNIDHKNKIKDWKKFLKNNTKNIIICGSLYFIP
LVYNYLTNNKF

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3n2aA	0.93	1.76	0.218	0.976	Download
2	1w78A	0.93	1.99	0.208	0.981	Download
3	2vosA	0.93	1.70	0.219	0.968	Download
4	2wtzB	0.74	3.80	0.143	0.895	Download
5	1o5zA1	0.49	1.50	0.261	0.507	Download
6	2gcaA1	0.46	1.75	0.298	0.480	Download
7	3gmzA	0.33	6.42	0.060	0.528	Download
8	4bubA2	0.29	2.77	0.165	0.321	Download
9	2r8wB1	0.27	5.04	0.046	0.383	Download
10	1yloA	0.27	5.62	0.038	0.388	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004326	1.00	tetrahydrofolylpolyglutamate synthase activity
GO:0008841	0.98	dihydrofolate synthase activity
GO:0005524	0.91	ATP binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044237	0.99	cellular metabolic process
GO:1901564	0.98	organonitrogen compound metabolic process
GO:0006760	0.97	folic acid-containing compound metabolic process
GO:1901566	0.96	organonitrogen compound biosynthetic process
GO:0044249	0.96	cellular biosynthetic process
GO:0009396	0.95	folic acid-containing compound biosynthetic process
GO:0046901	0.92	tetrahydrofolylpolyglutamate biosynthetic process
GO:0044699	0.77	single-organism process
GO:0044763	0.73	single-organism cellular process
GO:0044281	0.72	small molecule metabolic process
GO:0006730	0.64	one-carbon metabolic process
GO:0006761	0.58	dihydrofolate biosynthetic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0005737	0.82	cytoplasm
GO:0044444	0.80	cytoplasmic part
GO:0044446	0.74	intracellular organelle part
GO:0070013	0.72	intracellular organelle lumen
GO:0044429	0.72	mitochondrial part
GO:0005759	0.69	mitochondrial matrix

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.529	2vosA	0.942	1.67	0.215	0.984	6.3.2.17	46
2	0.433	1j6uA	0.671	3.83	0.157	0.811	6.3.2.8	46
3	0.408	1gqyB	0.716	3.60	0.120	0.841	6.3.2.8	46
4	0.332	2wtzB	0.745	3.79	0.149	0.895	6.3.2.13	46
5	0.327	2wtzD	0.712	3.62	0.144	0.844	6.3.2.13	46

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.69	3pyzA	0.934	1.78	0.218	0.978	1.32	ANP	Download	43,44,45,46,47,48,69,70,132,225,252,266,267,268,269,272,273,276,356
2	0.39	1fgsA	0.855	1.91	0.260	0.911	1.12	POP	Download	44,45,46,47,48,250
3	0.06	3qczA	0.933	1.72	0.218	0.976	1.26	GLU	Download	43,135,136,157,158,159,160,166,171,175
4	0.06	1w78A	0.931	1.99	0.210	0.984	1.19	PD8	Download	17,46,69,70,108,110,111,132,134,135,139,140,141,269

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]