[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S806795

(Click on S806795_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format

>protein
MDYKTKKNSNATVDIKLTFEASDIEKAFDKTYEEKQKNVKIPGFRPGKAPLNMVKRHLGD
SVASDAINTLIVDGMTSILSKLEHPMIRFPKFEIQDYQPGKNLIATAIYETNPEITLGKY
KKIKIKLPEVSVSDLDVSEEVEKVRKNLARKQLKEEGQAAVAGDIIDMEYTVCEKGQESK
NSGNTSNDYHLGHENNLKGFDENLYGMKSGEKKDFVHTFPEDYSQNEVAGKTFEYSVTIK
ALYANILPAVDDDLASEFDGSESLNVLKDKIRKNLKEGFEDRVKNKKLDEIYKEIIDDSK
YVFPESYLREESEHVFHNMIHEFKLPHMTMEKYANMVQKDLKEVQESFQKLAETRLKHYF
TRQKIAEIENISYSEQDFDADLEKLASSYQISLSDLKKELEKGKLMEQYRENFFAKKIDN
ILFDLVEKKYTDKLNIGQIKDYLNQKEEVKA

  Predicted Secondary Structure

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |           
MDYKTKKNSNATVDIKLTFEASDIEKAFDKTYEEKQKNVKIPGFRPGKAPLNMVKRHLGDSVASDAINTLIVDGMTSILSKLEHPMIRFPKFEIQDYQPGKNLIATAIYETNPEITLGKYKKIKIKLPEVSVSDLDVSEEVEKVRKNLARKQLKEEGQAAVAGDIIDMEYTVCEKGQESKNSGNTSNDYHLGHENNLKGFDENLYGMKSGEKKDFVHTFPEDYSQNEVAGKTFEYSVTIKALYANILPAVDDDLASEFDGSESLNVLKDKIRKNLKEGFEDRVKNKKLDEIYKEIIDDSKYVFPESYLREESEHVFHNMIHEFKLPHMTMEKYANMVQKDLKEVQESFQKLAETRLKHYFTRQKIAEIENISYSEQDFDADLEKLASSYQISLSDLKKELEKGKLMEQYRENFFAKKIDNILFDLVEKKYTDKLNIGQIKDYLNQKEEVKA
PredictionCCSSSSSCCCCSSSSSSSSCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCSSSSSSSSSCCSSCCCCCCCCSSSCCCCCCCHHHHHHHHHHHHHHCCCSSSCCCCCCCCCCCSSSSSSSSSSCCSSCCCCCCCCCSSSSCCCCCCHHHHHHHCCCCCCCSSSSSSSCCCCCCCHHHCCCSSSSSSSSSSSSSSCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSSSSCCCCHHHHHHHHCCHHHHCC
Conf.Score9408998789479999998799999999999999996478888789987699999998899999999999999999999865998288998775334679961899999641245135456742332787889999999999999965860554655201049989999999888811467653000798569985644899837998996689986686656755657983799999989999647777799998746877479999999999999999999999999999999984789899999999999999999999986599999998662246999999999999999999999999999948987999999999999998599999999999614689999999999999999997521741133207655332034232149
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |           
MDYKTKKNSNATVDIKLTFEASDIEKAFDKTYEEKQKNVKIPGFRPGKAPLNMVKRHLGDSVASDAINTLIVDGMTSILSKLEHPMIRFPKFEIQDYQPGKNLIATAIYETNPEITLGKYKKIKIKLPEVSVSDLDVSEEVEKVRKNLARKQLKEEGQAAVAGDIIDMEYTVCEKGQESKNSGNTSNDYHLGHENNLKGFDENLYGMKSGEKKDFVHTFPEDYSQNEVAGKTFEYSVTIKALYANILPAVDDDLASEFDGSESLNVLKDKIRKNLKEGFEDRVKNKKLDEIYKEIIDDSKYVFPESYLREESEHVFHNMIHEFKLPHMTMEKYANMVQKDLKEVQESFQKLAETRLKHYFTRQKIAEIENISYSEQDFDADLEKLASSYQISLSDLKKELEKGKLMEQYRENFFAKKIDNILFDLVEKKYTDKLNIGQIKDYLNQKEEVKA
Prediction7624245266241303030417403630351046116406051003130024103530263024300340035103400563704113305042651567330302020202040516606704043552604374036204401642352442646340354020101030314444164053661302013431153025003423363625050401651536613426040303044033542261124004415626205401640263036424443254114300430176170610440045104301430363046362426421633743274037413630242031300033006537151437403520351074273315303510456522530343022420031015305343355343652463445544468
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)


  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
Hit		Iden1Iden2CovNorm.
Z-score		Download
Align.		                   20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |           
Sec.Str
Seq		CCSSSSSCCCCSSSSSSSSCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCSSSSSSSSSCCSSCCCCCCCCSSSCCCCCCCHHHHHHHHHHHHHHCCCSSSCCCCCCCCCCCSSSSSSSSSSCCSSCCCCCCCCCSSSSCCCCCCHHHHHHHCCCCCCCSSSSSSSCCCCCCCHHHCCCSSSSSSSSSSSSSSCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSSSSCCCCHHHHHHHHCCHHHHCC
MDYKTKKNSNATVDIKLTFEASDIEKAFDKTYEEKQKNVKIPGFRPGKAPLNMVKRHLGDSVASDAINTLIVDGMTSILSKLEHPMIRFPKFEIQDYQPGKNLIATAIYETNPEITLGKYKKIKIKLPEVSVSDLDVSEEVEKVRKNLARKQLKEEGQAAVAGDIIDMEYTVCEKGQESKNSGNTSNDYHLGHENNLKGFDENLYGMKSGEKKDFVHTFPEDYSQNEVAGKTFEYSVTIKALYANILPAVDDDLASEFDGSESLNVLKDKIRKNLKEGFEDRVKNKKLDEIYKEIIDDSKYVFPESYLREESEHVFHNMIHEFKLPHMTMEKYANMVQKDLKEVQESFQKLAETRLKHYFTRQKIAEIENISYSEQDFDADLEKLASSYQISLSDLKKELEKGKLMEQYRENFFAKKIDNILFDLVEKKYTDKLNIGQIKDYLNQKEEVKA
11w26A 0.18 0.24 0.93 2.74Download -QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVP-NIVAQRYGASVRQDVLGDLSRNFIDAIIKEK-INPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVT-DADVDGLDTLRKQQATWKEKD--GAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLA--GQGRIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNE----------KQALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEEA-SAYEDPKEVIEFYSKNKEL--DNRNVALEEQAVEAVLAKAKVTEKETTFNELNQQA---------
27fbbA 0.10 0.19 0.74 0.65Download -----------EGKLVIWINGDKGYNGLAEVGKKFEKDTGI------KVHPDKLEEKFPQVAHDRFGGYAQQDKLYPFTWDA------------VRYN-GKLIAYPIAVEALSLIYNKDL-----------LPNEEIPALDKELKA---------KGKSLQEGGYAFKYAAGKYDIKDVNKHMNADTDMTINGPWAWSNIDT--SAVN------YGVTLP------TFKGQPVLSAGINAASPNK---ELAKEFLENY---LLTDEGLEAVNKDLKSYEEELAKDPRIAATMENAQKGEIMPNIPQM--SAFWYAVRTAVINAASGRQTV---------------DAALAAAQTNAAAADKVAVMAAMARLEMSLEEAAQYAVEL----GAGPETLKRIRSVREVAILIAISWLAKKVVDRVLLEH-------------------------
31w26 0.21 0.24 0.92 5.63Download -QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVP-NIVAQRYGASVRQDVLGDLSR-NFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGL-DTLRKQQ--ATWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVL-AGQGR-IPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELTAEFIKRFGEDGSVEGLRAEVRKN-ERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRF---GGN-------EKQALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEE-ASAYEDPKEVIEFYSKNKELD-N-RNVALEEQVEAVLAKAKVTEKETTFNNQQA------------
41w26 0.20 0.24 0.93 3.96Download -QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVP-NIVAQRYGASVRQDVLGDLSR-NFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGL-DTLRKQQATWKEKD--GAVEAEDRVTIDFTGSVDGEEFEGGKASDFVL-AGQGR-IPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELTAEFIKRFGEDGSVEGLRAEVRKN-ERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGG---N-------EKQALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEE-ASAYEDPKEVIEFYSKNKELDN--RNVALEEQAVEAVLAKAKVTEKE-TTFNELNQQA--------
51w26A 0.19 0.24 0.93 4.59Download -QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVP-NIVAQRYGASVRQDVLGDLSRN-FIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVD-GLDTLRKQQATWKEKD--GAVEAEDRVTIDFTGSVDGEEFEGGKASDF--VLAGQGRIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNE----------KQALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEEASA--YEDPKEVIEFYSKNKEL-DNRNVALEEQAVEAVLAKAKVTEKETTFNELNQQA---------
61w26 0.21 0.24 0.92 6.15Download -QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVP-NIVAQRYGASVRQDVLGDLSR-NFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGL-DTLRKQQATWKEKD--GAVEAEDRVTIDFTGSVDGEEFEGGKASDFVL-AGQGR-IPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELTAEFIKRFGEDGSVEGLRAEVRKN-ERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGG----------NEKQALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEE-ASAYED-PKEVIEFYSKNKELDN-RNVALEEQAVEAVLAKAKVTE-KETTFNELN-----------
71w26A 0.21 0.22 0.96 6.69Download MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQA--TWKEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDSVEGLRAEVRKNMERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNE----------KQALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMRNVALEEQAVEAVLAKAKVTEKETT----FNELMNQ----QA
87p3rA 0.06 0.12 0.67 1.38Download FL----------------------ATTVITAQCHAILNTQFTPPTVKPDWFDDLSKQWIDDLGPQVSAATFQASIDAIHELYKADPTASGKDNTT--------------------------------------VQQASQIMTALSSQVSGIEATVKGMNKE-----------------------------------LSDWGVKM----------------------------------------------QAAHDDLVNGATNIQKTIIDLQTDIESMNNAIDNNRAAIEKLNKDLVYA-----QVAVGVGIFMLVAGVALTVATAGTAAAVSGGIAAVGAASIIAGGVTWGVLQNQIDDDYDSIAQEQK---QKAEDQQQIIALQGLSNASSAVVSAIETSTSVLSDFETTWTVGNELDDVVTKLNNGASMQSIIMEKVMSDAAKNEELA
91w26A 0.20 0.24 0.93 6.87Download -QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVP-NIVAQRYGASVRQDVLGDLS-RNFIDAIIKEKINPAGAPTYVPGEYKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDG-LDTLRKQQATW--KEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASD--FVLAGQGRIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAKFAINLKKVEERELPELTAEFIKRFGEDGSVEGLRAEVRKN-ERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGN----------EKQALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEE-ASAYEDPKEVIEFYSKNKELDN--RNVALEEQAVEAVLAKAKVTEKETTFNELNQQA---------
101t11A 0.21 0.19 0.83 2.72Download MQVTVETLEGLQRRLNITVPAANIEDAVAAELRNIAKNRRFDGFRKGKVPMKMVAKMYGKAVRQDVLGEVMQRHFIEAIVKEKINPAGAPTFAPVEIGEGKDLVFTATFEVYPEVELKGLENIAVEKPAADADVAEMLETLRKQQA-----TWKEVDEAAENGKRVSIDFVGSIDGVEFEGGKAENFPLEMGAGRMIPGFEDGIVGKTKGMEFVIDVTFPEDYHAENLKGKAAKFAIKVNKVEARELPELNDEFVARFGVAGGVDALKAEVRKNMERELKQAIKARIKEQAIEGLVKENEIQVPSALIDQEINVLRQQAAQRFG----------GNVEAAAQLPRELFEEQAKRRVVVGLLLGEVIRTHELKADEEKVKALITEMATAY--------------------------------------------------------------
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: MUSTER   2: SPARKS-X   3: HHSEARCH2   4: HHSEARCH I   5: Neff-PPAS   6: HHSEARCH   7: pGenTHREADER   8: PROSPECT2   9: SP3   10: FFAS03   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=0.89 (Read more about C-score)
  • Estimated TM-score = 0.83±0.08
  • Estimated RMSD = 5.2±3.3Å

  • Download Model 2
  • C-score = -1.93

  • Download Model 3
  • C-score = -2.14

  • Download Model 4
  • C-score = -2.20

  • Download Model 5
  • C-score = -3.63


  Proteins structurally close to the target in the PDB (as identified by TM-align)

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)


Top 10 Identified stuctural analogs in PDB

Click
to view		RankPDB HitTM-scoreRMSDaIDENaCovAlignment
11w26A0.923 0.860.2050.931Download
23gtyX0.521 4.960.1310.674Download
31siwA0.372 7.600.0380.645Download
46zymA0.366 7.460.0420.619Download
55vkuL0.346 7.550.0360.592Download
63cwwB0.345 6.560.0410.519Download
77askF0.344 7.080.0260.556Download
81bg3B0.342 7.600.0470.592Download
94lglA0.341 7.560.0380.588Download
107k10A0.338 7.330.0420.559Download

(a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.


  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites


Click
to view		RankC-scoreCluster
size		 PDB
Hit		 Lig
Name		 Download
Complex		 Ligand Binding Site Residues
10.07 3 2zfzB ARG N/A 220,251
20.05 2 3hgzA PEPTIDE Rep, Mult 75,79,86
30.05 2 3m6zA MG N/A 353,356
40.05 2 3dpgA CA N/A 164,219
50.02 1 3oyxA GLV N/A 45,251


Download the residue-specific ligand binding probability, which is estimated by SVM.
Download the all possible binding ligands and detailed prediction summary.
Download the templates clustering results.
(a)C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)Cluster size is the total number of templates in a cluster.
(c)Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column.
Mult is the complex structures with all potential binding ligands in the cluster.

  Enzyme Commission (EC) numbers and active sites


Click
to view		RankCscoreECPDB
Hit		TM-scoreRMSDaIDENaCovEC NumberActive Site Residues
10.1901q16A0.330 7.810.0480.585 1.7.99.4  NA
20.1643dy5A0.315 7.330.0350.530 1.13.11.40 4.2.1.92  NA
30.1601kitA0.322 7.020.0460.519 3.2.1.18  NA
40.1592ivfA0.322 7.460.0330.554 1.17.99.2  NA
50.1552nztA0.324 7.550.0300.561 2.7.1.1  NA

 Click on the radio buttons to visualize predicted active site residues.
(a)CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1];
where a higher score indicates a more reliable EC number prediction.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided
by length of the query protein.

  Gene Ontology (GO) terms
Top 10 homologous GO templates in PDB 
RankCscoreGOTM-scoreRMSDaIDENaCovPDB HitAssociated GO Terms
1 0.530.9227 0.86 0.20 0.931w26A GO:0005625 GO:0044444 GO:0007049 GO:0044183 GO:0051301 GO:0006461 GO:0000413 GO:0016020 GO:0005829 GO:0005515 GO:0043022 GO:0003755 GO:0006457 GO:0051083 GO:0015031 GO:0016853
2 0.260.5209 4.96 0.13 0.673gtyX GO:0006457 GO:0000413 GO:0016853 GO:0007049 GO:0051301 GO:0005515 GO:0003755 GO:0015031
3 0.190.3297 7.81 0.05 0.591q16A GO:0009061 GO:0016651 GO:0042128 GO:0030151 GO:0016491 GO:0006810 GO:0005886 GO:0031224 GO:0005515 GO:0051536 GO:0009055 GO:0017004 GO:0042126 GO:0016020 GO:0005488 GO:0055114 GO:0051539 GO:0046872 GO:0008940 GO:0009325 GO:0022900
4 0.160.3238 7.55 0.03 0.562nztA GO:0005524 GO:0015758 GO:0005739 GO:0008645 GO:0003824 GO:0006096 GO:0005829 GO:0000166 GO:0016310 GO:0008637 GO:0004396 GO:0005536 GO:0007595 GO:0055085 GO:0008152 GO:0005741 GO:0016740 GO:0046835 GO:0006006 GO:0004340 GO:0016020 GO:0005975 GO:0016301 GO:0051156 GO:0046324 GO:0016773
5 0.150.3436 6.74 0.04 0.532g49A GO:0017046 GO:0005615 GO:0000166 GO:0046872 GO:0007548 GO:0005739 GO:0042447 GO:0031597 GO:0051291 GO:0010815 GO:0004871 GO:0042803 GO:0044257 GO:0051603 GO:0044419 GO:0006200 GO:0005782 GO:0005829 GO:0005524 GO:0016787 GO:0006508 GO:0005625 GO:0016887 GO:0004222 GO:0005515 GO:0005777 GO:0005634 GO:0045861 GO:0008270 GO:0050435 GO:0009986 GO:0001540 GO:0008233 GO:0007165 GO:0031626 GO:0051289 GO:0005737 GO:0008237 GO:0043559 GO:0003824
6 0.150.3117 5.22 0.12 0.421t11A GO:0006457 GO:0003755 GO:0016853 GO:0000413 GO:0007049 GO:0051301 GO:0015031
7 0.150.3222 7.02 0.05 0.521kitA GO:0016798 GO:0016787 GO:0004308 GO:0008152 GO:0005576
8 0.140.2795 3.26 0.15 0.322nsaA GO:0005515 GO:0051301 GO:0007049 GO:0006457 GO:0016853 GO:0000413 GO:0003755 GO:0015031
9 0.130.2283 2.63 0.21 0.251p9yA GO:0016020 GO:0005829 GO:0006461 GO:0051301 GO:0044183 GO:0007049 GO:0044444 GO:0016853 GO:0005625 GO:0015031 GO:0051083 GO:0006457 GO:0003755 GO:0043022 GO:0005515 GO:0000413
10 0.120.3260 6.94 0.04 0.531qhaA GO:0005829 GO:0016310 GO:0032403 GO:0018108 GO:0005536 GO:0010359 GO:0042803 GO:0016020 GO:0005515 GO:0006468 GO:0004340 GO:0004396 GO:0005524 GO:0003824 GO:0016740 GO:0000166 GO:0016301 GO:0043066 GO:0051156 GO:0006096 GO:0018105 GO:0016887 GO:0005901 GO:0043234 GO:0005975 GO:0006200 GO:0004672 GO:0016773 GO:0005739 GO:0018107 GO:0008152 GO:0046777 GO:0046835 GO:0005741 GO:0005634 GO:0008645 GO:0015758 GO:0005730 GO:0055085


Consensus prediction of GO terms		 
Molecular Function GO:0003755 GO:0035639 GO:0032559 GO:0044183 GO:0043022 GO:0051540 GO:0016661 GO:0046872 GO:0048029 GO:0019200
GO-Score 0.65 0.57 0.57 0.53 0.53 0.38 0.38 0.31 0.31 0.31
Biological Process GO:0007049 GO:0015031 GO:0051301 GO:0000413 GO:0051083 GO:0043623 GO:0045333 GO:0071941 GO:0006007 GO:0007589
GO-Score 0.65 0.65 0.65 0.65 0.53 0.38 0.38 0.38 0.31 0.31
Cellular Component GO:0005625 GO:0071944 GO:0044425 GO:0005740 GO:0031968 GO:0044445 GO:0044439 GO:0031907 GO:0044421 GO:0000502
GO-Score 0.60 0.38 0.38 0.31 0.31 0.31 0.31 0.31 0.31 0.31

(a)CscoreGO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on CscoreGO of the template.


[Click on S806795_results.tar.bz2 to download the tarball file including all modeling results listed on this page]


Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.