[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S806701

(Click on S806701_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format

>protein
MLHTVAEGRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAATDCKLWAIERQCFQ
TIMMRTGLIRQAEYTDFLKSVPIFKNLPEETLTKISDVLEETFYRPGDYIIRQGARGDTF
FIISKGQVKVTIKQPNSEEEKYIRTLQKGDFFGEKALQGDDLRTANIIADEQEGVTCLVI
DRETFNQLISSLDEIRTRYKDEGVERRRINEEFRDVKLADLRILATLGVGGFGRVELVQI
AGDPTRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCDFIVKLFKTFKDRKYLYMLME
SCLGGELWTILRDKGHFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLDVNGYVK
LVDFGFAKKLQQGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFT
GSDPMKTYNIILKGIDAIEFPRNITRNATALIKKLCRDNPTERLGYQKGGISEIQKHKWF
DGFNWEGLINHTLIPPITPKVRNVTDTSNFDEYPPDTEGPPLDDLTGWDAEF

  Predicted Secondary Structure

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |            
MLHTVAEGRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAATDCKLWAIERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKNLPEETLTKISDVLEETFYRPGDYIIRQGARGDTFFIISKGQVKVTIKQPNSEEEKYIRTLQKGDFFGEKALQGDDLRTANIIADEQEGVTCLVIDRETFNQLISSLDEIRTRYKDEGVERRRINEEFRDVKLADLRILATLGVGGFGRVELVQIAGDPTRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCDFIVKLFKTFKDRKYLYMLMESCLGGELWTILRDKGHFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLDVNGYVKLVDFGFAKKLQQGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATALIKKLCRDNPTERLGYQKGGISEIQKHKWFDGFNWEGLINHTLIPPITPKVRNVTDTSNFDEYPPDTEGPPLDDLTGWDAEF
PredictionCSSSSSSSSSSSSSCCSSSSSCCCCCCHHHHHHHCCCCCCCSSSSCCCSSSSSSSHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCHHHHHHHHHHCSSSSSCCCCSSSSCCCCCCSSSSSSCCSSSSSSSCCCCCCCCSSSSCCCCCCCCHHHHCCCCCCCCCSSSSCCCCCSSSSSCHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHSSSSSSSSSCCCSSSSSSSSSCCCCCSSSSSSSSHHHHHHCCHHHHHHHHHHHHHHCCCCSSCCSSSSSSCCCSSSSSSCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCSSCCCCCHHHSSSCCCCCSSSCCCCCCSSCCCCCCSSSCCCCHHHCCHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHCCCCCCCHHHHHCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCC
Conf.Score9899975399999999998974898740142664189765279988775999986899999987767999999999986378662299999999997653899779998985898377799996788999873688876401586046660366775547765563685169971589820899987506898876553444555420244558788799189999982796389999996798958999998788877325899999999999767998398753597159868999868886669999840587892788999999999999898689162379889947888998897127766568999976631488375469887789988458787589999876028899898998999999972788777898689999999998766987780799998889985698768989999970899899267779985155518999878999988677887889
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |            
MLHTVAEGRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAATDCKLWAIERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKNLPEETLTKISDVLEETFYRPGDYIIRQGARGDTFFIISKGQVKVTIKQPNSEEEKYIRTLQKGDFFGEKALQGDDLRTANIIADEQEGVTCLVIDRETFNQLISSLDEIRTRYKDEGVERRRINEEFRDVKLADLRILATLGVGGFGRVELVQIAGDPTRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCDFIVKLFKTFKDRKYLYMLMESCLGGELWTILRDKGHFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLDVNGYVKLVDFGFAKKLQQGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATALIKKLCRDNPTERLGYQKGGISEIQKHKWFDGFNWEGLINHTLIPPITPKVRNVTDTSNFDEYPPDTEGPPLDDLTGWDAEF
Prediction4000034030101244430340341300001001131312010303240200002260034003434333243023003304203503451033004103443066321003134412100002403030214346464431023044231000200146332313030446620200103362035203305403543445434443354634503051031010003001010200232536421000000216401534224003302300430600000201100205410000000000000011035333062620000000000001101734000000100000003600000000000130657530100000000000000363302100000000000000100200032711330032015126404004301630230033004421430021243005103613004602063036360512030304365001101413634753236623411663
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)


  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
Hit
Iden1Iden2CovNorm.
Z-score
Download
Align.
                   20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                 380                 400                 420                 440                 460                 480                 500                 520
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |            
Sec.Str
Seq
CSSSSSSSSSSSSSCCSSSSSCCCCCCHHHHHHHCCCCCCCSSSSCCCSSSSSSSHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCHHHHHHHHHHCSSSSSCCCCSSSSCCCCCCSSSSSSCCSSSSSSSCCCCCCCCSSSSCCCCCCCCHHHHCCCCCCCCCSSSSCCCCCSSSSSCHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHSSSSSSSSSCCCSSSSSSSSSCCCCCSSSSSSSSHHHHHHCCHHHHHHHHHHHHHHCCCCSSCCSSSSSSCCCSSSSSSCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCSSCCCCCHHHSSSCCCCCSSSCCCCCCSSCCCCCCSSSCCCCHHHCCHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHCCCCCCCHHHHHCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCC
MLHTVAEGRVEVSRENKYLSTLAPGKVFGELAILYNCKRTATIKAATDCKLWAIERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKNLPEETLTKISDVLEETFYRPGDYIIRQGARGDTFFIISKGQVKVTIKQPNSEEEKYIRTLQKGDFFGEKALQGDDLRTANIIADEQEGVTCLVIDRETFNQLISSLDEIRTRYKDEGVERRRINEEFRDVKLADLRILATLGVGGFGRVELVQIAGDPTRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCDFIVKLFKTFKDRKYLYMLMESCLGGELWTILRDKGHFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLDVNGYVKLVDFGFAKKLQQGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMKTYNIILKGIDAIEFPRNITRNATALIKKLCRDNPTERLGYQKGGISEIQKHKWFDGFNWEGLINHTLIPPITPKVRNVTDTSNFDEYPPDTEGPPLDDLTGWDAEF
16c0tA 0.67 0.43 0.63 2.72Download -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGK-KTWFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
27axtA 0.37 0.26 0.64 2.48Download ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GHMGNAAAAKKGEQESVKEFLAKAKEEFLKKWESPNTAQLDHFDRIKTLG-----RVMLVKHK-ETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKG--RTW-LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEE---EEIREKCGKEFTEF
34myi 0.37 0.35 0.92 1.19Download YFFIINSGKFDVYVNDKKVKSMGKGSSFGEAALIHNTQRSATIMAETDGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMITNACVIQMFKPGETIVKQGDYGDVLFILKEGKATVFIND------KEIRVLNKGSYFGERALLYDEPRSATIIAKEP--TACASICRKLLNIVLGNLQVVLFRNIEEGIKPRTISMQDTKVEMHELETERIIGRG-FGTVKLVHHKP-TQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRTFKD--CFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKIQG--RAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYEFICGPLPFGNEDQLEIFRDILTGQ--LTFPDYVSQDSINLMKRLLCRLPQGRIGCSINGFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGETYA---------------------------
44myi 0.37 0.35 0.92 0.85Download YFFIINSGKFDVYVNDKKVKSMGKGSSFGEAALIHNTQRSATIMAETDGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMITNACVIQMFKPGETIVKQGDYGDVLFILKEGKATVFIND------KEIRVLNKGSYFGERALLYDEPRSATIIAKEP--TACASICRKLLNIVLGNLQVVLFRNHERFLRTALIATQDTKVEMHELETERIIGRG-FGTVKLVHHKP-TQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRTFKD--CFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKIQ--GRAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYEFICGPLPFGNEDQLEIFRDILTG--QLTFPDYVSQDSINLMKRLLCRLPQGRIGCSINGFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGETYA---------------------------
54myiA 0.36 0.35 0.90 3.25Download KYLIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQKQKRHTVKSLDVCKIALITESCLADCLGDDASIDHNNKKSIIKKMYIFRYLSEQQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEVTK-------NKRLRTLGKNDYFGERALLYDEPRTASIISKAT-SVECWFVDKSVFLQIIQGPMLTHLEERIKMQDT--------KVEMHELETERIIGRG-FGTVKLVHHK-PTQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRTFKD--CFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKI--QGRAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYEFICGPLPFGNEDQLEIFRDILTG--QLTFPDYVDQDSINLMKRLLCRLPQGRIGCSINGFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGETYA---------------------------
64myi 0.37 0.35 0.91 1.27Download -FFIINSGKFDVYVNDKKVKSMGKGSSFGEAALIHNTQRSATIMAETDGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMITNACVIQMFKPGETIVKQGDYGDVLFILKEGKATVFIND------KEIRVLNKGSYFGERALLYDEPRSATIIAKE--PTACASICRKLLNIVLGNLQVVLFRNIMTEALKASIKMQDTKVEMHELETERIIGRG-FGTVKLVHHKP-TQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRTFKD--CFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKIQG--RAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYEFICGPLPFGNEDQLEIFRDILTGQ--LTFPDYVSQDSINLMKRLLCRLPQGRIGCSINGFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGE------------------------------
75dzcA 0.36 0.35 0.9210.74Download KYLIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQKQKFRTVKSLDVCKIALITESCLADCLGIDASIDHNNKKSIIKKMYIFRYLSEQQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEVTKNG------KRLRTLGKNDYFGERALLYDEPRTASIISKATS-VECWFVDKSVFLQ-IIQGPMLTHLEERIKMQDTKVEMHE-------LETERIIGRGTFGTVKLVHHK-PTQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRTFKDSNCFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKI--QGRAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYEFICGPLPFGNEDQLEIFRDILTG--QLTFPDYVSQDSINLMKRLLCRLPQGRIGCSINGFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGETAEDIDSWD---------------------
87axtA 0.36 0.26 0.64 3.68Download -----------------------------------------------------------------------------------------------------------------GHMGN---------------------------------------------------------------AAAAKKGEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKT-----LGRVMLVKHK-ETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKR---VKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIREKCGKEFT---EF
95dzcA 0.36 0.35 0.92 3.70Download KYLIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQKQKRHTVKSLDVCKIALITESCLADCLGIDASIDHNNKKSIIKKMYIFRYLSEQQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEVTK------NGKRLRTLGKNDYFGERALLYDEPRTASIIS-KATSVECWFVDKSVFLQIIQ--------GPMLTHLEERIKMQDTKVEMHELETERIIGRGTFGTVKLVHHK-PTQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRTFKDSNCFYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKI--QGRAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYEFICGPLPFGNEDQLEIFRDILTG--QLTFPDYVDQDSINLMKRLLCRLPQGRIGCSINGFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGEYAEDIDSWD---------------------
104myiA 0.37 0.35 0.91 4.46Download -FFIINSGKFDVYVNDKKVKSMGKGSSFGEAALIHNTQRSATIMAETDGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMITNACVIQMFKPGETIVKQGDYGDVLFILKEGKATVF------INDKEIRVLNKGSYFGERALLYDEPRSATIIAKEP--TACASICRKLLNIVLGNLQVVLFRNIMTEALEERIKMQDTKVEMHELETERIIGRG-FGTVKLVH---PTQIRYALKCVSKRSIISLNQQNNIKLEREITAENDHPFIIRLVRTFKDC--FYFLTELVTGGELYDAIRKLGLLSKPQAQFYLGSIILAIEYLHERNIVYRDLKPENILLDKQGYVKLIDFGCAKKIQG--RAYTLVGTPHYMAPEVILGKGYGCTVDIWALGVCLYEFICGPLPFDQEDQLEIFRDILTG--QLTFPDYVSQDSINLMKRLLCRLPQGRIGCSINGFKDIKEHAFFGNFNWDKLAGRLLEPPLVSKGETYA---------------------------
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: MUSTER   2: SPARKS-X   3: HHSEARCH2   4: HHSEARCH I   5: Neff-PPAS   6: HHSEARCH   7: pGenTHREADER   8: PROSPECT2   9: SP3   10: FFAS03   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=-0.22 (Read more about C-score)
  • Estimated TM-score = 0.68±0.12
  • Estimated RMSD = 7.9±4.4Å

  • Download Model 2
  • C-score = -0.94

  • Download Model 3
  • C-score = -3.41

  • Download Model 4
  • C-score = -3.22

  • Download Model 5
  • C-score = -3.35


  Proteins structurally close to the target in the PDB (as identified by TM-align)

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)


Top 10 Identified stuctural analogs in PDB

Click
to view
RankPDB HitTM-scoreRMSDaIDENaCovAlignment
15dzcA0.918 1.580.3560.940Download
26c0tA0.580 2.350.7000.613Download
32vo0A0.572 2.350.3780.605Download
43a8xA0.559 2.320.3160.592Download
54yhjA0.557 2.540.1910.596Download
63nynA0.553 2.690.1840.594Download
72jedA0.552 2.110.3520.583Download
83d0eA0.552 2.300.3490.587Download
96pjxA0.550 2.740.1800.592Download
103cqwA0.550 2.150.3700.579Download

(a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.


  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites


Click
to view
RankC-scoreCluster
size
PDB
Hit
Lig
Name
Download
Complex
Ligand Binding Site Residues
10.62 640 2uztA SS3 Rep, Mult 227,228,229,235,249,251,283,299,300,301,302,306,349,350,352,362,363,504
20.14 139 1sveA PEPTIDE Rep, Mult 263,306,308,309,312,347,348,349,366,379,380,381,382,384,411,415,416,417,420,421,422,427,428,511,513
30.10 64 1xh6A R94 Rep, Mult 228,229,230,231,232,233,234,235,249,251,263,270,299,300,301,302,306,349,350,352,362,363,365,366,510
40.05 53 1atpE MN Rep, Mult 347,350,363
50.04 61 2j4zA 626 N/A 227,249,283,300,301,302,303,305,309,349,350,352,362,369


Download the residue-specific ligand binding probability, which is estimated by SVM.
Download the all possible binding ligands and detailed prediction summary.
Download the templates clustering results.
(a)C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)Cluster size is the total number of templates in a cluster.
(c)Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column.
Mult is the complex structures with all potential binding ligands in the cluster.

  Enzyme Commission (EC) numbers and active sites


Click
to view
RankCscoreECPDB
Hit
TM-scoreRMSDaIDENaCovEC NumberActive Site Residues
10.5181cmkE0.567 2.570.3660.605 2.7.11.11 2.7.1.37  345,347,349,350
20.2212jedA0.553 2.080.3520.583 2.7.11.13  NA
30.2183d0eA0.555 2.310.3500.590 2.7.11.1  NA
40.2172esmA0.551 2.600.3140.590 2.7.11.1  NA
50.2173cquA0.549 2.330.3550.583 2.7.11.26 2.7.11.1  NA

 Click on the radio buttons to visualize predicted active site residues.
(a)CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1];
where a higher score indicates a more reliable EC number prediction.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided
by length of the query protein.

  Gene Ontology (GO) terms
Top 10 homologous GO templates in PDB 
RankCscoreGOTM-scoreRMSDaIDENaCovPDB HitAssociated GO Terms
1 0.400.5670 2.57 0.37 0.611cmkE GO:0005829 GO:0046777 GO:0001707 GO:0005634 GO:0005737 GO:0071374 GO:0043234 GO:0043457 GO:0016772 GO:0019901 GO:0006468 GO:0005886 GO:0016310 GO:0031594 GO:0050804 GO:0046827 GO:0005624 GO:0018105 GO:0005515 GO:0004674 GO:0005626 GO:0051966 GO:0016301 GO:0005794 GO:0032403 GO:0048471 GO:0005524 GO:0005654 GO:0005625 GO:0005952 GO:0004672 GO:0005739 GO:0051447 GO:0000166 GO:0004691 GO:0016740 GO:0004862 GO:0007243 GO:0055085 GO:0048011 GO:0000278 GO:0005975 GO:0071377 GO:0034199 GO:0007596 GO:0006112 GO:0000086 GO:0006094 GO:0006833 GO:0019433 GO:0050796 GO:0006006 GO:0007202 GO:0005813 GO:0006629
2 0.220.5483 2.65 0.20 0.593c4wB GO:0016740 GO:0050254 GO:0016301 GO:0000166 GO:0050896 GO:0016020 GO:0007601 GO:0016310 GO:0005524 GO:0004674 GO:0004672 GO:0004703 GO:0004871 GO:0006468 GO:0007165 GO:0016772
3 0.220.5591 2.32 0.32 0.593a8xA GO:0004672 GO:0004674 GO:0005524 GO:0006468 GO:0016772
4 0.220.5528 2.08 0.35 0.582jedA GO:0004672 GO:0004674 GO:0005524 GO:0006468 GO:0016772
5 0.220.5547 2.48 0.37 0.593qkmA GO:0046777 GO:0043066 GO:0006468 GO:0006954 GO:0010975 GO:0009408 GO:0019899 GO:0045944 GO:0032094 GO:0045884 GO:0005524 GO:0006810 GO:0031295 GO:0010765 GO:0032880 GO:0035556 GO:0030168 GO:0008286 GO:0005737 GO:0006412 GO:0005654 GO:0008633 GO:0001893 GO:0030030 GO:0016301 GO:0031018 GO:0048011 GO:0051091 GO:0046889 GO:0030235 GO:0034405 GO:0008643 GO:0015758 GO:0045600 GO:0046326 GO:0007399 GO:0007186 GO:0009725 GO:0030163 GO:0042640 GO:0005978 GO:0006809 GO:0005979 GO:0016070 GO:0015630 GO:0018105 GO:0048009 GO:0005515 GO:0007165 GO:0005634 GO:0005547 GO:0051000 GO:0042593 GO:0033138 GO:0050999 GO:0006469 GO:0090004 GO:0000166 GO:0007596 GO:0060709 GO:0045725 GO:0005975 GO:0060716 GO:0016740 GO:0070141 GO:0016020 GO:0004674 GO:0010907 GO:0008629 GO:0006464 GO:0005977 GO:0046209 GO:0048015 GO:0001649 GO:0045792 GO:0071363 GO:0006417 GO:0051146 GO:0005625 GO:0031659 GO:0030334 GO:0005829 GO:0016071 GO:0042802 GO:0005819 GO:0016310 GO:0016567 GO:0043536 GO:0006924 GO:0006916 GO:0043325 GO:0010748 GO:0006915 GO:0007281 GO:0005886 GO:0004672 GO:0030027 GO:0030307 GO:0032869 GO:0043491 GO:0001934 GO:0032270 GO:0031999 GO:0008637 GO:0032436 GO:0046329 GO:0045429 GO:0000060 GO:0006006 GO:0016772
6 0.220.5521 2.27 0.20 0.583pfqA GO:0045471 GO:0043123 GO:0031526 GO:0042488 GO:0009749 GO:0030374 GO:0003682 GO:0006915 GO:0035408 GO:0046872 GO:0005886 GO:0005737 GO:0005622 GO:0004697 GO:0016740 GO:0035403 GO:0004674 GO:0016310 GO:0016020 GO:0005625 GO:0005813 GO:0014059 GO:0000166 GO:0035556 GO:0006468 GO:0005524 GO:0042493 GO:0050681 GO:0006355 GO:0016568 GO:0034339 GO:0005634 GO:0042113 GO:0016301 GO:0005829 GO:0042393 GO:0006351 GO:0005626 GO:0050853 GO:0033280 GO:0005624 GO:0040008 GO:0004672 GO:0005515 GO:0008270 GO:0016772
7 0.220.5512 2.60 0.31 0.592esmA GO:0004672 GO:0004674 GO:0005524 GO:0006468 GO:0016772
8 0.220.5526 2.69 0.18 0.593nynA GO:0005524 GO:0016740 GO:0016020 GO:0016310 GO:0008277 GO:0004703 GO:0004674 GO:0016301 GO:0000166 GO:0004672 GO:0004871 GO:0006468 GO:0007165 GO:0016772
9 0.220.5440 2.63 0.31 0.582f2uA GO:0004672 GO:0004674 GO:0005524 GO:0006468 GO:0016772
10 0.220.5553 2.31 0.35 0.593d0eA GO:0004672 GO:0004674 GO:0005524 GO:0006468 GO:0016772


Consensus prediction of GO terms
 
Molecular Function GO:0005524 GO:0060089 GO:0035091 GO:0019901 GO:0004691 GO:0032403 GO:0004862
GO-Score 0.78 0.45 0.44 0.40 0.40 0.40 0.40
Biological Process GO:0046777 GO:0007596 GO:0048011 GO:0050953 GO:0050870 GO:0006606 GO:0010962 GO:0003006 GO:0033135 GO:0045834
GO-Score 0.53 0.53 0.53 0.45 0.44 0.44 0.44 0.44 0.44 0.44
Cellular Component GO:0005886 GO:0005625 GO:0005654 GO:0005829 GO:0042995 GO:0031252 GO:0005794 GO:0005813 GO:0048471 GO:0005739
GO-Score 0.53 0.53 0.53 0.53 0.44 0.44 0.40 0.40 0.40 0.40

(a)CscoreGO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on CscoreGO of the template.


[Click on S806701_results.tar.bz2 to download the tarball file including all modeling results listed on this page]



Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.