[Home] [Server] [Queue] [About] [Remove] [Statistics]

I-TASSER results for job id S802163

(Click on S802163_results.tar.bz2 to download the tarball file including all modeling results listed on this page. Click on Annotation of I-TASSER Output to read the instructions for how to interpret the results on this page. Model results are kept on the server for 60 days, there is no way to retrieve the modeling data older than 2 months)

  Submitted Sequence in FASTA format

>protein
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF

  Predicted Secondary Structure

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |            
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
PredictionCCCCCCCCCCCCCCCHHCSSSCCSSCCCCCSSSSSSSSCCCCCSSSSSSSCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCSSSSSSCCCCCCCCCCCSSSSSSSCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHSSSCCCCCSSSCCCCCCCCCCCCCCCCCCCCCCCSSSCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHCCHHHCCCCCCCCHHHCCCCCCCHHHHHHCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
Conf.Score984234666788870310467357616888689889999999989998734777766783139999999976899899874568831466656778849999748133399999618999798999999999999999998698424868889930789999887987565216887777766888976535258879976997658799999989999999709888899988999999999709989477747333756534678888997989976877999899999998668395226389999689601789898896567898885255420101012330254544467899877877789999
H:Helix; S:Strand; C:Coil

  Predicted Solvent Accessibility

Sequence                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |            
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Prediction644326527233133053042033011211030110213624300000202145273001000200030035061610030210020323445543200000010023003200633736033710210030003003101733000000101000024700000000000021223365553500110000001000000116614110000000000000114301121631340032005000001673433133034045140343334402630461233620030033004111731120530061610356132361660153343632525445444644465644654454554655536223
Values range from 0 (buried residue) to 9 (highly exposed residue)

   Predicted normalized B-factor

(B-factor is a value to indicate the extent of the inherent thermal mobility of residues/atoms in proteins. In I-TASSER, this value is deduced from threading template proteins from the PDB in combination with the sequence profiles derived from sequence databases. The reported B-factor profile in the figure below corresponds to the normalized B-factor of the target protein, defined by B=(B'-u)/s, where B' is the raw B-factor value, u and s are respectively the mean and standard deviation of the raw B-factors along the sequence. Click here to read more about predicted normalized B-factor)


  Top 10 threading templates used by I-TASSER

(I-TASSER modeling starts from the structure templates identified by LOMETS from the PDB library. LOMETS is a meta-server threading approach containing multiple threading programs, where each threading program can generate tens of thousands of template alignments. I-TASSER only uses the templates of the highest significance in the threading alignments, the significance of which are measured by the Z-score, i.e. the difference between the raw and average scores in the unit of standard deviation. The templates in this section are the 10 best templates selected from the LOMETS threading programs. Usually, one template of the highest Z-score is selected from each threading program, where the threading programs are sorted by the average performance in the large-scale benchmark test experiments.)

Rank PDB
Hit		Iden1Iden2CovNorm.
Z-score		Download
Align.		                   20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |            
Sec.Str
Seq		CCCCCCCCCCCCCCCHHCSSSCCSSCCCCCSSSSSSSSCCCCCSSSSSSSCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCSSSSSSCCCCCCCCCCCSSSSSSSCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHSSSCCCCCSSSCCCCCCCCCCCCCCCCCCCCCCCSSSCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHCCHHHCCCCCCCCHHHCCCCCCCHHHHHHCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
14cjyC 0.47 0.40 0.81 3.32Download ----------WGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDK-----KDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES----RPYNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTM--KPQYRRRLREEFSFI--PSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAP--P--------------------------------------------
27nwkA 0.97 0.80 0.80 2.42Download ------SVECPFCDEVSKYEKLAKIGQG-FGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK--------GSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAF-----SLPNRY-NRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDN-LVKGQKRK-------VKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG----------------------------------------------
33blr 0.98 0.81 0.81 0.62Download ------SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT----------SIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAP-----NRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLEL-----VKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG----------------------------------------------
45z33 0.29 0.31 0.96 0.54Download QGRKIFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNNQTSEGVAIKKVTNVFSKKILAKRALREIKLLQHFRHRNITCLYDMDIPRP----DNFNETYLYEELMECDLAAIIRS-GQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVNLPFMAKKPFPTLFPN--ANPDALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFD-FEVVE-DVGEMRKMILDEVYRFLEAELAGGLD-----
57nxjA 0.44 0.41 0.87 3.30Download ---------DWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKED--KKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEES----RPYNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFI--PAAALDLFDYMLALDPSKRCTAEQALQCEFLRDEPSKMPPPDLPLWQDCHELWSK---------------------------------
65z33 0.33 0.31 0.81 0.71Download --------------VDERYTVTKELGQGAYGIVCAAVNNQTSEGVAIKKVTNVFSKKILAKRALREIKLLQHFRHRNITCLYDMDIPRP----DNFNETYLYEELMECDLAAIIRSG-QPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRLPFMAKKPFPTLFP--NANPDALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDAS--------------------------------------------------
75efqA 0.48 0.40 0.80 8.77Download -------ID-WGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDK-------EGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYS---SEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFI--PAAALDLFDYMLALDPSKRCTAEQALQCEFLR--------------------------------------------------------
87nwkA 0.97 0.80 0.80 3.77Download ------SVECPFCDEVSKYEKLAKIGQG-FGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK--------GSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLP------NRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNLVKG--------QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG----------------------------------------------
94ogrA 0.99 0.84 0.84 3.11Download -------VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK--------GSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQ-PNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLST------------------------------------------
106gzhA 0.98 0.83 0.83 5.21Download -------VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKA------SGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAQPN----RYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKG----------------------------------------------
(a)All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)Rank of templates represents the top ten threading templates used by I-TASSER.
(c)Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)Cov represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
       1: MUSTER   2: SPARKS-X   3: HHSEARCH2   4: HHSEARCH I   5: Neff-PPAS   6: HHSEARCH   7: pGenTHREADER   8: PROSPECT2   9: SP3   10: FFAS03   

   Top 5 final models predicted by I-TASSER

(For each target, I-TASSER simulations generate a large ensemble of structural conformations, called decoys. To select the final models, I-TASSER uses the SPICKER program to cluster all the decoys based on the pair-wise structure similarity, and reports up to five models which corresponds to the five largest structure clusters. The confidence of each model is quantitatively measured by C-score that is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5, 2], where a C-score of a higher value signifies a model with a higher confidence and vice-versa. TM-score and RMSD are estimated based on C-score and protein length following the correlation observed between these qualities. Since the top 5 models are ranked by the cluster size, it is possible that the lower-rank models have a higher C-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests. If the I-TASSER simulations converge, it is possible to have less than 5 clusters generated; this is usually an indication that the models have a good quality because of the converged simulations.)
    (By right-click on the images, you can export image file or change the configurations, e.g. modifying the background color or stopping the spin of your models)
  • Download Model 1
  • C-score=-1.19 (Read more about C-score)
  • Estimated TM-score = 0.57±0.15
  • Estimated RMSD = 9.4±4.6Å

  • Download Model 2
  • C-score = -0.64

  • Download Model 3
  • C-score = -2.17

  • Download Model 4
  • C-score = -2.69

  • Download Model 5
  • C-score = -2.30


  Proteins structurally close to the target in the PDB (as identified by TM-align)

(After the structure assembly simulation, I-TASSER uses the TM-align structural alignment program to match the first I-TASSER model to all structures in the PDB library. This section reports the top 10 proteins from the PDB that have the closest structural similarity, i.e. the highest TM-score, to the predicted I-TASSER model. Due to the structural similarity, these proteins often have similar function to the target. However, users are encouraged to use the data in the next section 'Predicted function using COACH' to infer the function of the target protein, since COACH has been extensively trained to derive biological functions from multi-source of sequence and structure features which has on average a higher accuracy than the function annotations derived only from the global structure comparison.)


Top 10 Identified stuctural analogs in PDB

Click
to view		RankPDB HitTM-scoreRMSDaIDENaCovAlignment
13miaA0.820 2.110.9570.860Download
27nxjA0.806 2.200.4490.866Download
37kpvA0.775 2.820.3150.860Download
46z3uB0.772 2.480.3460.847Download
54cjyC0.769 1.980.4650.815Download
67jv7A0.759 1.890.3960.798Download
76y0aA0.751 2.760.2910.825Download
86gubA0.748 1.690.3900.785Download
95z33A0.745 2.570.2870.815Download
101pf6A0.739 3.240.7110.841Download

(a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.


  Predicted function using COFACTOR and COACH

(This section reports biological annotations of the target protein by COFACTOR and COACH based on the I-TASSER structure prediction. While COFACTOR deduces protein functions (ligand-binding sites, EC and GO) using structure comparison and protein-protein networks, COACH is a meta-server approach that combines multiple function annotation results (on ligand-binding sites) from the COFACTOR, TM-SITE and S-SITE programs.)

  Ligand binding sites


Click
to view		RankC-scoreCluster
size		 PDB
Hit		 Lig
Name		 Download
Complex		 Ligand Binding Site Residues
10.95 1637 2c5yA MTW Rep, Mult 25,26,27,28,33,46,48,79,103,104,105,106,107,108,109,153,156,167
20.12 187 3ds6B A17 Rep, Mult 25,33,46,48,66,69,70,79,101,103,104,105,106,107,108,109,156,166,167,170
30.04 65 3nnvA 437 Rep, Mult 46,48,62,65,66,69,70,73,79,101,103,147,165,166,167
40.04 80 2wmbA MG Rep, Mult 154,167
50.03 38 1q99B ANP Rep, Mult 27,28,29,30,31,33,46,48,79,104,106,167,170


Download the residue-specific ligand binding probability, which is estimated by SVM.
Download the all possible binding ligands and detailed prediction summary.
Download the templates clustering results.
(a)C-score is the confidence score of the prediction. C-score ranges [0-1], where a higher score indicates a more reliable prediction.
(b)Cluster size is the total number of templates in a cluster.
(c)Lig Name is name of possible binding ligand. Click the name to view its information in the BioLiP database.
(d)Rep is a single complex structure with the most representative ligand in the cluster, i.e., the one listed in the Lig Name column.
Mult is the complex structures with all potential binding ligands in the cluster.

  Enzyme Commission (EC) numbers and active sites


Click
to view		RankCscoreECPDB
Hit		TM-scoreRMSDaIDENaCovEC NumberActive Site Residues
10.5293blrA0.803 0.650.9830.809 2.7.11.23 2.7.11.22  149,151,153,154
20.2891unlA0.727 2.190.4000.780 2.7.11.22  NA
30.2812pk9A0.710 2.160.3850.761 2.7.11.22  NA
40.2782qkrA0.674 2.520.3900.731 2.7.11.22  NA
50.2762r3kA0.674 2.470.4010.742 2.7.11.22  NA

 Click on the radio buttons to visualize predicted active site residues.
(a)CscoreEC is the confidence score for the EC number prediction. CscoreEC values range in between [0-1];
where a higher score indicates a more reliable EC number prediction.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided
by length of the query protein.

  Gene Ontology (GO) terms
Top 10 homologous GO templates in PDB 
RankCscoreGOTM-scoreRMSDaIDENaCovPDB HitAssociated GO Terms
1 0.420.7272 2.19 0.40 0.781unlA GO:0016740 GO:0050321 GO:0030426 GO:0043125 GO:0008045 GO:0043025 GO:0021695 GO:0022038 GO:0032801 GO:0046777 GO:0009611 GO:0030334 GO:0009790 GO:0031594 GO:0030424 GO:0043525 GO:0005176 GO:0021819 GO:0021954 GO:0021987 GO:0030182 GO:0030425 GO:0045892 GO:0008633 GO:0001963 GO:0006915 GO:0021549 GO:0030900 GO:0031914 GO:0043113 GO:0044428 GO:0048148 GO:0051402 GO:0008306 GO:0021766 GO:0016477 GO:0033136 GO:0048167 GO:0048812 GO:0002039 GO:0042995 GO:0005634 GO:0030549 GO:0007411 GO:0005829 GO:0007596 GO:0016533 GO:0031397 GO:0045956 GO:0048813 GO:0060079 GO:0000166 GO:0045055 GO:0045786 GO:0060078 GO:0007160 GO:0021697 GO:0006887 GO:0004674 GO:0045860 GO:0046826 GO:0048488 GO:0007409 GO:0005524 GO:0005737 GO:0016310 GO:0004672 GO:0001764 GO:0014044 GO:0006886 GO:0008542 GO:0016301 GO:0031175 GO:0030027 GO:0004693 GO:0006468 GO:0006913 GO:0021537 GO:0030866 GO:0042220 GO:0005856 GO:0019233 GO:0051301 GO:0005515 GO:0008283 GO:0007519 GO:0035249 GO:0007049 GO:0016020 GO:0018105 GO:0030175 GO:0016772
2 0.290.8189 2.13 0.96 0.863mi9A GO:0008353 GO:0050434 GO:0005730 GO:0003677 GO:0004693 GO:0000166 GO:0010467 GO:0016301 GO:0008023 GO:0006366 GO:0005515 GO:0004672 GO:0008283 GO:0005634 GO:0043231 GO:0006468 GO:0006367 GO:0017069 GO:0006351 GO:0005654 GO:0004674 GO:0006355 GO:0016032 GO:0016740 GO:0005524 GO:0006368 GO:0007049 GO:0016310 GO:0016772
3 0.280.7102 2.16 0.39 0.762pk9A GO:0005737 GO:0031647 GO:0000166 GO:0016301 GO:0006974 GO:0045719 GO:0007049 GO:0000122 GO:0045936 GO:0016740 GO:0000083 GO:0004693 GO:0005515 GO:0016310 GO:0050849 GO:0016239 GO:0005634 GO:0016242 GO:0032880 GO:0000307 GO:0006468 GO:0032878 GO:0043433 GO:0005524 GO:0004674 GO:0004672 GO:0016772
4 0.280.7053 2.74 0.40 0.773nizA GO:0016310 GO:0000166 GO:0016301 GO:0005524 GO:0004672 GO:0004674 GO:0006468 GO:0016772
5 0.270.6480 2.31 0.38 0.711oiqA GO:0000085 GO:0000805 GO:0016310 GO:0005654 GO:0000084 GO:0051439 GO:0005667 GO:0006813 GO:0000216 GO:0005829 GO:0042802 GO:0035173 GO:0000793 GO:0004672 GO:0016301 GO:0016740 GO:0004693 GO:0005737 GO:0008284 GO:0031145 GO:0000806 GO:0016772 GO:0051301 GO:0007089 GO:0005634 GO:0000278 GO:0007265 GO:0000307 GO:0000781 GO:0007067 GO:0007596 GO:0006260 GO:0000075 GO:0016572 GO:0006468 GO:0005524 GO:0005515 GO:0000166 GO:0007049 GO:0000082 GO:0006275 GO:0000086 GO:0006977 GO:0004674
6 0.250.7145 2.61 0.27 0.782b9iA GO:0043332 GO:0010526 GO:0004707 GO:0005524 GO:0051301 GO:0004672 GO:0004674 GO:0016740 GO:0001403 GO:0042597 GO:0000166 GO:0016301 GO:0007067 GO:0016310 GO:0006468 GO:0007050 GO:0000750 GO:0005737 GO:0043409 GO:0016772 GO:0007049 GO:0005634 GO:0000746 GO:0005515 GO:0005739
7 0.240.7179 2.98 0.23 0.802h96A GO:0004674 GO:0045087 GO:0006468 GO:0005524 GO:0004705 GO:0005886 GO:0016301 GO:0051403 GO:0005829 GO:0034142 GO:0002224 GO:0034134 GO:0008063 GO:0016310 GO:0002755 GO:0000166 GO:0034130 GO:0051090 GO:0005515 GO:0007258 GO:0005737 GO:0004707 GO:0004708 GO:0005739 GO:0002756 GO:0016740 GO:0007254 GO:0007165 GO:0005654 GO:0034138 GO:0004672 GO:0016772
8 0.240.6910 3.12 0.24 0.781pmuA GO:0016301 GO:0005886 GO:0005829 GO:0034142 GO:0002224 GO:0034134 GO:0008063 GO:0016310 GO:0002755 GO:0000166 GO:0034130 GO:0051090 GO:0005515 GO:0007258 GO:0005737 GO:0004707 GO:0004708 GO:0005739 GO:0002756 GO:0016740 GO:0007254 GO:0007165 GO:0005654 GO:0045087 GO:0004674 GO:0034138 GO:0006468 GO:0005524 GO:0004705 GO:0051403 GO:0004672 GO:0016772
9 0.240.7347 3.04 0.26 0.821j1bB GO:0051059 GO:0005829 GO:0050321 GO:0002039 GO:0001837 GO:0034236 GO:0005977 GO:0005886 GO:0016772 GO:0000166 GO:0045732 GO:0001954 GO:0071109 GO:0030877 GO:0004672 GO:0048015 GO:0001085 GO:0005813 GO:0031625 GO:0005634 GO:0004674 GO:0016310 GO:0005515 GO:0006468 GO:0007411 GO:0031333 GO:0021766 GO:0060070 GO:0005737 GO:0016301 GO:0005524 GO:0048011 GO:0035556 GO:0046827 GO:0008013 GO:0032091 GO:0005730 GO:0016055 GO:0016740 GO:0043066 GO:0031334 GO:0032886 GO:0018105 GO:0006983 GO:0034747 GO:0032855 GO:0016020
10 0.230.7007 2.61 0.26 0.773nieA GO:0004672 GO:0004674 GO:0004707 GO:0005524 GO:0006468 GO:0016772


Consensus prediction of GO terms		 
Molecular Function GO:0005524 GO:0004693 GO:0043125 GO:0005176 GO:0030549 GO:0002039 GO:0050321
GO-Score 0.84 0.78 0.42 0.42 0.42 0.42 0.42
Biological Process GO:0051301 GO:0007596 GO:0031328 GO:2000243 GO:0048524 GO:0051254 GO:0046782 GO:0006354 GO:0010563 GO:0050848
GO-Score 0.58 0.58 0.57 0.57 0.57 0.57 0.57 0.57 0.56 0.56
Cellular Component GO:0005829 GO:0044451 GO:0000803 GO:0044427 GO:0016020 GO:0030027 GO:0016533 GO:0005856 GO:0043025 GO:0030425
GO-Score 0.58 0.57 0.55 0.55 0.42 0.42 0.42 0.42 0.42 0.42

(a)CscoreGO is a combined measure for evaluating global and local similarity between query and template protein. It's range is [0-1] and higher values indicate more confident predictions.
(b)TM-score is a measure of global structural similarity between query and template protein.
(c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
(d)IDENa is the percentage sequence identity in the structurally aligned region.
(e)Cov represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.
(f)The second table shows a consensus GO terms amongst the top scoring templates. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on CscoreGO of the template.


[Click on S802163_results.tar.bz2 to download the tarball file including all modeling results listed on this page]


Please cite the following articles when you use the I-TASSER server:
  • Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. Cell Reports Methods, 1: 100014 (2021).
  • Chengxin Zhang, Peter L. Freddolino, and Yang Zhang. COFACTOR: improved protein function prediction by combining structure, sequence and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017).
  • Jianyi Yang, Yang Zhang. I-TASSER server: new development for protein structure and function predictions, Nucleic Acids Research, 43: W174-W181, 2015.