Swiss ID: mtr1b_human |
Protein Name: Melatonin type 1B (Mel-1B-R) |
Organism: Human |
Seqeunce Length: 362 |
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD AL |
Experimental Restraints: |
: MSA PMID of associated paper: 0 |
Orientation Restraint: S123 PMID of associated paper: 12826274 |
Orientation Restraint: S127 PMID of associated paper: 12826274 |
Orientation Restraint: H208 PMID of associated paper: 12826274 |
Orientation Restraint: F257 PMID of associated paper: 12826274 |
Orientation Restraint: W264 PMID of associated paper: 12826274 |
Orientation Restraint: G271 PMID of associated paper: 15525337 |
Orientation Restraint: L272 PMID of associated paper: 15525337 |
Orientation Restraint: S293 PMID of associated paper: 12826274 |
Experimental Data: |
Experimental Data: S123A PMID of associated paper: 12826274 |
Experimental Data: S127A PMID of associated paper: 12826274 |
Experimental Data: S127N PMID of associated paper: 12826274 |
Experimental Data: H208A PMID of associated paper: 12826274 |
Experimental Data: H208F PMID of associated paper: 12826274 |
Experimental Data: F257A PMID of associated paper: 12826274 |
Experimental Data: F257W PMID of associated paper: 12826274 |
Experimental Data: W264A PMID of associated paper: 12826274 |
Experimental Data: W264S PMID of associated paper: 12826274 |
Experimental Data: G271T PMID of associated paper: 15525337 |
Experimental Data: L272A PMID of associated paper: 15525337 |
Experimental Data: S293A PMID of associated paper: 12826274 |
Experimental Data: S123A PMID of associated paper: 12826274 |
Experimental Data: S127A PMID of associated paper: 12826274 |
Experimental Data: S127N PMID of associated paper: 12826274 |
Experimental Data: N175A PMID of associated paper: 12826274 |
Experimental Data: N175H PMID of associated paper: 12826274 |
Experimental Data: V205A PMID of associated paper: 15525337 |
Experimental Data: H208A PMID of associated paper: 12826274 |
Experimental Data: H208F PMID of associated paper: 12826274 |
Experimental Data: F209A PMID of associated paper: 15525337 |
Experimental Data: F257A PMID of associated paper: 12826274 |
Experimental Data: F257W PMID of associated paper: 12826274 |
Experimental Data: W264A PMID of associated paper: 12826274 |
Experimental Data: W264S PMID of associated paper: 12826274 |
Experimental Data: G271T PMID of associated paper: 15525337 |
Experimental Data: L272A PMID of associated paper: 15525337 |
Experimental Data: S293A PMID of associated paper: 12826274 |
Experimental Data: Y298A PMID of associated paper: 15525337 |
Experimental Data: MSA PMID of associated paper: 0 |
GPCR Related Corss-reference Links: |
GPCRDB GPCR-OKB UniProt_P49286 |