Experimental restraint
Download GPCR Model
Swiss ID: mtr1b_human
Protein Name: Melatonin type 1B (Mel-1B-R)
Organism: Human
Seqeunce Length: 362
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Experimental Restraints:
MSA  PMID of associated paper:  0
Orientation Restraint: S123  PMID of associated paper:  12826274
Orientation Restraint: S127  PMID of associated paper:  12826274
Orientation Restraint: H208  PMID of associated paper:  12826274
Orientation Restraint: F257  PMID of associated paper:  12826274
Orientation Restraint: W264  PMID of associated paper:  12826274
Orientation Restraint: G271  PMID of associated paper:  15525337
Orientation Restraint: L272  PMID of associated paper:  15525337
Orientation Restraint: S293  PMID of associated paper:  12826274
Experimental Data:
Experimental Data: S123A  PMID of associated paper:  12826274
Experimental Data: S127A  PMID of associated paper:  12826274
Experimental Data: S127N  PMID of associated paper:  12826274
Experimental Data: H208A  PMID of associated paper:  12826274
Experimental Data: H208F  PMID of associated paper:  12826274
Experimental Data: F257A  PMID of associated paper:  12826274
Experimental Data: F257W  PMID of associated paper:  12826274
Experimental Data: W264A  PMID of associated paper:  12826274
Experimental Data: W264S  PMID of associated paper:  12826274
Experimental Data: G271T  PMID of associated paper:  15525337
Experimental Data: L272A  PMID of associated paper:  15525337
Experimental Data: S293A  PMID of associated paper:  12826274
Experimental Data: S123A  PMID of associated paper:  12826274
Experimental Data: S127A  PMID of associated paper:  12826274
Experimental Data: S127N  PMID of associated paper:  12826274
Experimental Data: N175A  PMID of associated paper:  12826274
Experimental Data: N175H  PMID of associated paper:  12826274
Experimental Data: V205A  PMID of associated paper:  15525337
Experimental Data: H208A  PMID of associated paper:  12826274
Experimental Data: H208F  PMID of associated paper:  12826274
Experimental Data: F209A  PMID of associated paper:  15525337
Experimental Data: F257A  PMID of associated paper:  12826274
Experimental Data: F257W  PMID of associated paper:  12826274
Experimental Data: W264A  PMID of associated paper:  12826274
Experimental Data: W264S  PMID of associated paper:  12826274
Experimental Data: G271T  PMID of associated paper:  15525337
Experimental Data: L272A  PMID of associated paper:  15525337
Experimental Data: S293A  PMID of associated paper:  12826274
Experimental Data: Y298A  PMID of associated paper:  15525337
Experimental Data: MSA  PMID of associated paper:  0
GPCR Related Corss-reference Links:
GPCRDB
GPCR-OKB
UniProt_P49286