Experimental restraint
Download GPCR Model
Swiss ID: gasr_human
Protein Name: Gastrin/cholecystokinin type B receptor (CCK-B rec
Organism: Homo sapiens (Human).
Seqeunce Length: 447
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
Multiple Sequence Alignment
Experimental Restraints:
Contact Restraint: A62-A104  PMID of associated paper:  7890609
Contact Restraint: G135-M186  PMID of associated paper:  10908308
Contact Restraint: W346-S379  PMID of associated paper:  10908308
MSA  PMID of associated paper:  0
Orientation Restraint: V63  PMID of associated paper:  7890609
Orientation Restraint: I75  PMID of associated paper:  7890609
Orientation Restraint: M67  PMID of associated paper:  7890609
Orientation Restraint: A104  PMID of associated paper:  7890609
Orientation Restraint: L184  PMID of associated paper:  7890609
Orientation Restraint: L185  PMID of associated paper:  7890609
Orientation Restraint: I229  PMID of associated paper:  7890609
Orientation Restraint: F228  PMID of associated paper:  7890609
Orientation Restraint: A235  PMID of associated paper:  7890609
Orientation Restraint: V232  PMID of associated paper:  7890609
Orientation Restraint: L336  PMID of associated paper:  7890609
Orientation Restraint: Y350  PMID of associated paper:  7890609
Orientation Restraint: V389  PMID of associated paper:  7890609
Orientation Restraint: A149  PMID of associated paper:  7890609
Orientation Restraint: L225  PMID of associated paper:  7890609
Orientation Restraint: L347  PMID of associated paper:  7890609
Orientation Restraint: A381  PMID of associated paper:  7890609
Orientation Restraint: G135  PMID of associated paper:  10908308
Orientation Restraint: S379  PMID of associated paper:  10908308
Experimental Data:
Experimental Data: V63I  PMID of associated paper:  7890609
Experimental Data: I75V  PMID of associated paper:  7890609
Experimental Data: M67L  PMID of associated paper:  7890609
Experimental Data: A104C  PMID of associated paper:  7890609
Experimental Data: L184T  PMID of associated paper:  7890609
Experimental Data: L185I  PMID of associated paper:  7890609
Experimental Data: I229L  PMID of associated paper:  7890609
Experimental Data: F228L  PMID of associated paper:  7890609
Experimental Data: A235V  PMID of associated paper:  7890609
Experimental Data: V232L  PMID of associated paper:  7890609
Experimental Data: L336I  PMID of associated paper:  7890609
Experimental Data: Y350F  PMID of associated paper:  7890609
Experimental Data: H394N  PMID of associated paper:  7890609
Experimental Data: V389I  PMID of associated paper:  7890609
Experimental Data: V63L  PMID of associated paper:  7890609
Experimental Data: A91I  PMID of associated paper:  7890609
Experimental Data: A149S  PMID of associated paper:  7890609
Experimental Data: A235M  PMID of associated paper:  7890609
Experimental Data: I229T  PMID of associated paper:  7890609
Experimental Data: L225I  PMID of associated paper:  7890609
Experimental Data: L347M  PMID of associated paper:  7890609
Experimental Data: T354A  PMID of associated paper:  7890609
Experimental Data: A381T  PMID of associated paper:  7890609
Experimental Data: G135A  PMID of associated paper:  10908308
Experimental Data: Y350A  PMID of associated paper:  10908308
Experimental Data: N353L  PMID of associated paper:  10908308
Experimental Data: S379A  PMID of associated paper:  10908308
Experimental Data: A62-A104  PMID of associated paper:  7890609
Experimental Data: G135-M186  PMID of associated paper:  10908308
Experimental Data: W346-S379  PMID of associated paper:  10908308
Experimental Data: A62S  PMID of associated paper:  7890609
Experimental Data: V63I  PMID of associated paper:  7890609
Experimental Data: I75V  PMID of associated paper:  7890609
Experimental Data: V77T  PMID of associated paper:  7890609
Experimental Data: G70L  PMID of associated paper:  7890609
Experimental Data: M67L  PMID of associated paper:  7890609
Experimental Data: A104C  PMID of associated paper:  7890609
Experimental Data: A106F  PMID of associated paper:  7890609
Experimental Data: L102M  PMID of associated paper:  7890609
Experimental Data: V105L  PMID of associated paper:  7890609
Experimental Data: L143F  PMID of associated paper:  7890609
Experimental Data: S144N  PMID of associated paper:  7890609
Experimental Data: A172L  PMID of associated paper:  7890609
Experimental Data: R173K  PMID of associated paper:  7890609
Experimental Data: G183F  PMID of associated paper:  7890609
Experimental Data: L184T  PMID of associated paper:  7890609
Experimental Data: L185I  PMID of associated paper:  7890609
Experimental Data: V187T  PMID of associated paper:  7890609
Experimental Data: I229L  PMID of associated paper:  7890609
Experimental Data: F228L  PMID of associated paper:  7890609
Experimental Data: A235V  PMID of associated paper:  7890609
Experimental Data: V232L  PMID of associated paper:  7890609
Experimental Data: L336I  PMID of associated paper:  7890609
Experimental Data: Y350F  PMID of associated paper:  7890609
Experimental Data: V349I  PMID of associated paper:  7890609
Experimental Data: L388I  PMID of associated paper:  7890609
Experimental Data: V389I  PMID of associated paper:  7890609
Experimental Data: M73T  PMID of associated paper:  7890609
Experimental Data: T59L  PMID of associated paper:  7890609
Experimental Data: V63L  PMID of associated paper:  7890609
Experimental Data: A149S  PMID of associated paper:  7890609
Experimental Data: L133F  PMID of associated paper:  7890609
Experimental Data: V136T  PMID of associated paper:  7890609
Experimental Data: L180C  PMID of associated paper:  7890609
Experimental Data: V176A  PMID of associated paper:  7890609
Experimental Data: A235M  PMID of associated paper:  7890609
Experimental Data: I229T  PMID of associated paper:  7890609
Experimental Data: L225I  PMID of associated paper:  7890609
Experimental Data: L347M  PMID of associated paper:  7890609
Experimental Data: A383S  PMID of associated paper:  7890609
Experimental Data: A381T  PMID of associated paper:  7890609
Experimental Data: H376L  PMID of associated paper:  7890609
Experimental Data: V349L  PMID of associated paper:  8185216
Experimental Data: Y61A  PMID of associated paper:  10908308
Experimental Data: G135A  PMID of associated paper:  10908308
Experimental Data: M186A  PMID of associated paper:  10908308
Experimental Data: L226A  PMID of associated paper:  10908308
Experimental Data: F227A  PMID of associated paper:  10908308
Experimental Data: W346A  PMID of associated paper:  10908308
Experimental Data: V349A  PMID of associated paper:  10908308
Experimental Data: Y350A  PMID of associated paper:  10908308
Experimental Data: S379A  PMID of associated paper:  10908308
Experimental Data: MSA  PMID of associated paper:  0
GPCR Related Corss-reference Links:
GPCRDB
GPCR-OKB
UniProt_P32239