Swiss ID: gasr_human |
Protein Name: Gastrin/cholecystokinin type B receptor (CCK-B rec |
Organism: Homo sapiens (Human). |
Seqeunce Length: 447 |
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL PDEDPPTPSIASLSRLSYTTISTLGPG |
Experimental Restraints: |
Contact Restraint: A62-A104 PMID of associated paper: 7890609 |
Contact Restraint: G135-M186 PMID of associated paper: 10908308 |
Contact Restraint: W346-S379 PMID of associated paper: 10908308 |
: MSA PMID of associated paper: 0 |
Orientation Restraint: V63 PMID of associated paper: 7890609 |
Orientation Restraint: I75 PMID of associated paper: 7890609 |
Orientation Restraint: M67 PMID of associated paper: 7890609 |
Orientation Restraint: A104 PMID of associated paper: 7890609 |
Orientation Restraint: L184 PMID of associated paper: 7890609 |
Orientation Restraint: L185 PMID of associated paper: 7890609 |
Orientation Restraint: I229 PMID of associated paper: 7890609 |
Orientation Restraint: F228 PMID of associated paper: 7890609 |
Orientation Restraint: A235 PMID of associated paper: 7890609 |
Orientation Restraint: V232 PMID of associated paper: 7890609 |
Orientation Restraint: L336 PMID of associated paper: 7890609 |
Orientation Restraint: Y350 PMID of associated paper: 7890609 |
Orientation Restraint: V389 PMID of associated paper: 7890609 |
Orientation Restraint: A149 PMID of associated paper: 7890609 |
Orientation Restraint: L225 PMID of associated paper: 7890609 |
Orientation Restraint: L347 PMID of associated paper: 7890609 |
Orientation Restraint: A381 PMID of associated paper: 7890609 |
Orientation Restraint: G135 PMID of associated paper: 10908308 |
Orientation Restraint: S379 PMID of associated paper: 10908308 |
Experimental Data: |
Experimental Data: V63I PMID of associated paper: 7890609 |
Experimental Data: I75V PMID of associated paper: 7890609 |
Experimental Data: M67L PMID of associated paper: 7890609 |
Experimental Data: A104C PMID of associated paper: 7890609 |
Experimental Data: L184T PMID of associated paper: 7890609 |
Experimental Data: L185I PMID of associated paper: 7890609 |
Experimental Data: I229L PMID of associated paper: 7890609 |
Experimental Data: F228L PMID of associated paper: 7890609 |
Experimental Data: A235V PMID of associated paper: 7890609 |
Experimental Data: V232L PMID of associated paper: 7890609 |
Experimental Data: L336I PMID of associated paper: 7890609 |
Experimental Data: Y350F PMID of associated paper: 7890609 |
Experimental Data: H394N PMID of associated paper: 7890609 |
Experimental Data: V389I PMID of associated paper: 7890609 |
Experimental Data: V63L PMID of associated paper: 7890609 |
Experimental Data: A91I PMID of associated paper: 7890609 |
Experimental Data: A149S PMID of associated paper: 7890609 |
Experimental Data: A235M PMID of associated paper: 7890609 |
Experimental Data: I229T PMID of associated paper: 7890609 |
Experimental Data: L225I PMID of associated paper: 7890609 |
Experimental Data: L347M PMID of associated paper: 7890609 |
Experimental Data: T354A PMID of associated paper: 7890609 |
Experimental Data: A381T PMID of associated paper: 7890609 |
Experimental Data: G135A PMID of associated paper: 10908308 |
Experimental Data: Y350A PMID of associated paper: 10908308 |
Experimental Data: N353L PMID of associated paper: 10908308 |
Experimental Data: S379A PMID of associated paper: 10908308 |
Experimental Data: A62-A104 PMID of associated paper: 7890609 |
Experimental Data: G135-M186 PMID of associated paper: 10908308 |
Experimental Data: W346-S379 PMID of associated paper: 10908308 |
Experimental Data: A62S PMID of associated paper: 7890609 |
Experimental Data: V63I PMID of associated paper: 7890609 |
Experimental Data: I75V PMID of associated paper: 7890609 |
Experimental Data: V77T PMID of associated paper: 7890609 |
Experimental Data: G70L PMID of associated paper: 7890609 |
Experimental Data: M67L PMID of associated paper: 7890609 |
Experimental Data: A104C PMID of associated paper: 7890609 |
Experimental Data: A106F PMID of associated paper: 7890609 |
Experimental Data: L102M PMID of associated paper: 7890609 |
Experimental Data: V105L PMID of associated paper: 7890609 |
Experimental Data: L143F PMID of associated paper: 7890609 |
Experimental Data: S144N PMID of associated paper: 7890609 |
Experimental Data: A172L PMID of associated paper: 7890609 |
Experimental Data: R173K PMID of associated paper: 7890609 |
Experimental Data: G183F PMID of associated paper: 7890609 |
Experimental Data: L184T PMID of associated paper: 7890609 |
Experimental Data: L185I PMID of associated paper: 7890609 |
Experimental Data: V187T PMID of associated paper: 7890609 |
Experimental Data: I229L PMID of associated paper: 7890609 |
Experimental Data: F228L PMID of associated paper: 7890609 |
Experimental Data: A235V PMID of associated paper: 7890609 |
Experimental Data: V232L PMID of associated paper: 7890609 |
Experimental Data: L336I PMID of associated paper: 7890609 |
Experimental Data: Y350F PMID of associated paper: 7890609 |
Experimental Data: V349I PMID of associated paper: 7890609 |
Experimental Data: L388I PMID of associated paper: 7890609 |
Experimental Data: V389I PMID of associated paper: 7890609 |
Experimental Data: M73T PMID of associated paper: 7890609 |
Experimental Data: T59L PMID of associated paper: 7890609 |
Experimental Data: V63L PMID of associated paper: 7890609 |
Experimental Data: A149S PMID of associated paper: 7890609 |
Experimental Data: L133F PMID of associated paper: 7890609 |
Experimental Data: V136T PMID of associated paper: 7890609 |
Experimental Data: L180C PMID of associated paper: 7890609 |
Experimental Data: V176A PMID of associated paper: 7890609 |
Experimental Data: A235M PMID of associated paper: 7890609 |
Experimental Data: I229T PMID of associated paper: 7890609 |
Experimental Data: L225I PMID of associated paper: 7890609 |
Experimental Data: L347M PMID of associated paper: 7890609 |
Experimental Data: A383S PMID of associated paper: 7890609 |
Experimental Data: A381T PMID of associated paper: 7890609 |
Experimental Data: H376L PMID of associated paper: 7890609 |
Experimental Data: V349L PMID of associated paper: 8185216 |
Experimental Data: Y61A PMID of associated paper: 10908308 |
Experimental Data: G135A PMID of associated paper: 10908308 |
Experimental Data: M186A PMID of associated paper: 10908308 |
Experimental Data: L226A PMID of associated paper: 10908308 |
Experimental Data: F227A PMID of associated paper: 10908308 |
Experimental Data: W346A PMID of associated paper: 10908308 |
Experimental Data: V349A PMID of associated paper: 10908308 |
Experimental Data: Y350A PMID of associated paper: 10908308 |
Experimental Data: S379A PMID of associated paper: 10908308 |
Experimental Data: MSA PMID of associated paper: 0 |
GPCR Related Corss-reference Links: |
GPCRDB GPCR-OKB UniProt_P32239 |