Experimental restraint
Download GPCR Model
Swiss ID: drd1_human
Protein Name: D(1A) dopamine
Organism: Human
Seqeunce Length: 446
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Multiple Sequence Alignment
Experimental Restraints:
Contact Restraint: D70-C106  PMID of associated paper:  8466481
Contact Restraint: C283-F319  PMID of associated paper:  8466481
MSA  PMID of associated paper:  0
Orientation Restraint: S107  PMID of associated paper:  8466481
Orientation Restraint: S199  PMID of associated paper:  8466481
Orientation Restraint: D70  PMID of associated paper:  8466481
Orientation Restraint: C283  PMID of associated paper:  8466481
Orientation Restraint: F319  PMID of associated paper:  8466481
Orientation Restraint: I205  PMID of associated paper:  8913366
Orientation Restraint: L286  PMID of associated paper:  8913366
Experimental Data:
Experimental Data: F264I  PMID of associated paper:  8910419
Experimental Data: R266K  PMID of associated paper:  8910419
Experimental Data: C347G  PMID of associated paper:  7643110
Experimental Data: C351G  PMID of associated paper:  7643110
Experimental Data: S107G  PMID of associated paper:  8466481
Experimental Data: S199V  PMID of associated paper:  8466481
Experimental Data: D70V  PMID of associated paper:  8466481
Experimental Data: K81E  PMID of associated paper:  8466481
Experimental Data: C283V  PMID of associated paper:  8466481
Experimental Data: F319L  PMID of associated paper:  8466481
Experimental Data: S199A  PMID of associated paper:  1355478
Experimental Data: I205A  PMID of associated paper:  8913366
Experimental Data: I205Y  PMID of associated paper:  8913366
Experimental Data: L286A  PMID of associated paper:  8913366
Experimental Data: L286Y  PMID of associated paper:  8913366
Experimental Data: D70-C106  PMID of associated paper:  8466481
Experimental Data: C283-F319  PMID of associated paper:  8466481
Experimental Data: I49  PMID of associated paper:  9603612
Experimental Data: D70  PMID of associated paper:  8466481
Experimental Data: C106A  PMID of associated paper:  8466481
Experimental Data: S107G  PMID of associated paper:  8466481
Experimental Data: S199V  PMID of associated paper:  8466481
Experimental Data: S202A  PMID of associated paper:  8466481
Experimental Data: D70V  PMID of associated paper:  8466481
Experimental Data: C283V  PMID of associated paper:  8466481
Experimental Data: F319L  PMID of associated paper:  8466481
Experimental Data: W321Y  PMID of associated paper:  8466481
Experimental Data: S198A  PMID of associated paper:  1355478
Experimental Data: S199A  PMID of associated paper:  1355478
Experimental Data: I205A  PMID of associated paper:  8913366
Experimental Data: I205Y  PMID of associated paper:  8913366
Experimental Data: L286A  PMID of associated paper:  8913366
Experimental Data: L286Y  PMID of associated paper:  8913366
Experimental Data: L274  PMID of associated paper:  8098694
Experimental Data: MSA  PMID of associated paper:  0
GPCR Related Corss-reference Links:
GPCRDB
GPCR-OKB
UniProt_P21728