Experimental restraint
You do not have the
Java Runtime Environment
installed for applet support.
Visit www.java.com
Download GPCR Model
Swiss ID: ada2a_human
Protein Name: Alpha-2A adrenergic receptor (Alpha-2A adrenocepto
Organism: Homo sapiens (Human).
Seqeunce Length: 450
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Experimental Restraints:
Contact Restraint: D113-D79  PMID of associated paper:  1678850
MSA  PMID of associated paper:  0
Orientation Restraint: D113  PMID of associated paper:  1678850
Orientation Restraint: F412  PMID of associated paper:  1678390
Orientation Restraint: C201  PMID of associated paper:  9495800
Orientation Restraint: I198  PMID of associated paper:  9495800
Orientation Restraint: S199  PMID of associated paper:  9495800
Orientation Restraint: I202  PMID of associated paper:  10419505
Experimental Data:
Experimental Data: D113N  PMID of associated paper:  1678850
Experimental Data: F412N  PMID of associated paper:  1678390
Experimental Data: C201S  PMID of associated paper:  9495800
Experimental Data: I198C  PMID of associated paper:  9495800
Experimental Data: S199C  PMID of associated paper:  9495800
Experimental Data: C201C  PMID of associated paper:  10419505
Experimental Data: I202S  PMID of associated paper:  10419505
Experimental Data: D113-D79  PMID of associated paper:  1678850
Experimental Data: D113N  PMID of associated paper:  1678850
Experimental Data: D79N  PMID of associated paper:  1678850
Experimental Data: S200A  PMID of associated paper:  1678850
Experimental Data: S204A  PMID of associated paper:  1678850
Experimental Data: F412N  PMID of associated paper:  1678390
Experimental Data: E107  PMID of associated paper:  2836950
Experimental Data: I211  PMID of associated paper:  2836950
Experimental Data: C201S  PMID of associated paper:  9495800
Experimental Data: V197C  PMID of associated paper:  9495800
Experimental Data: I198C  PMID of associated paper:  9495800
Experimental Data: S199C  PMID of associated paper:  9495800
Experimental Data: S200C  PMID of associated paper:  9495800
Experimental Data: S204C  PMID of associated paper:  9495800
Experimental Data: S165A  PMID of associated paper:  9309797
Experimental Data: C201C  PMID of associated paper:  10419505
Experimental Data: I202S  PMID of associated paper:  10419505
Experimental Data: G203S  PMID of associated paper:  10419505
Experimental Data: S204S  PMID of associated paper:  10419505
Experimental Data: V197S  PMID of associated paper:  10438518
Experimental Data: S200S  PMID of associated paper:  10438518
Experimental Data: MSA  PMID of associated paper:  0
GPCR Related Corss-reference Links:
GPCRDB
GPCR-OKB
UniProt_P08913