Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Gastrin/cholecystokinin type B receptor
Species	Bos taurus (Bovine)
Gene	CCKBR
Synonym	CCK-B receptor CCK-BR CCK2-R Cholecystokinin-2 receptor
Disease	N/A for non-human GPCRs
Length	454
Amino acid sequence	MELLKPNRSVLGSGPGPGASLCRSGGPLLNGSGTGNLSCEPPRIRGAGTRELELAIRVTLYAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVVCKAVSYFMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWMLSGLLMVPYPVYTAVQPAGPRVLQCMHRWPSARVRQTWSVLLLLLLFFVPGVVMAVAYGLISRELYLGLRFDGDSDSESQSRVGSQGGLPGGTGQGPAQANGRCRSETRLAGEDGDGCYVQLPRSRPALEMSALTAPTPGPGSGTRPAQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLTYASACVNPLVYCFMHRRFRQACLDTCTRCCPRPPRARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
UniProt	P79266
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL2720
IUPHAR	N/A
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
4786	CHEMBL124719	C42H50N8O13S2	939.025	14 / 11	0.6	No
25067	CHEMBL338056	C41H48N8O13S2	924.998	14 / 11	0.4	No
31894	CHEMBL407530	C48H61N9O11S3	1036.25	13 / 9	1.8	No
39362	CHEMBL411202	C47H60N10O12S3	1053.23	14 / 11	0.1	No
40147	CHEMBL2370120	C50H63N9O12S2	1046.22	14 / 11	1.7	No
89046	CHEMBL436199	C45H56N8O13S2	981.106	14 / 11	1.7	No
94333	CHEMBL2370119	C49H61N9O12S2	1032.2	14 / 11	1.4	No
107873	CHEMBL438773	C47H59N9O13S3	1054.22	15 / 11	0.7	No
107875	CHEMBL438911	C47H59N9O13S3	1054.22	15 / 11	0.7	No
136173	CHEMBL2079606	C48H59N13O10S2	1042.2	15 / 11	1.2	No
136175	CHEMBL2079547	C48H59N13O10S2	1042.2	15 / 11	1.2	No
150338	CHEMBL2079601	C49H61N13O10S2	1056.23	15 / 11	1.5	No
150340	CHEMBL2079551	C49H61N13O10S2	1056.23	15 / 11	1.5	No
157104	CHEMBL126008	C46H50N8O13S2	987.069	14 / 11	2.2	No
159967	CHEMBL2112635	C47H58N8O13S2	1007.14	14 / 11	2.3	No
165953	CHEMBL386376	C47H52N8O13S2	1001.1	14 / 11	2.6	No
168390	CHEMBL267849	C46H57N9O14S3	1056.19	16 / 12	0.8	No
172522	CHEMBL2079548	C48H59N9O12S2	1018.17	14 / 11	1.5	No
172524	CHEMBL2079604	C48H59N9O12S2	1018.17	14 / 11	1.5	No
190199	CHEMBL411079	C49H63N9O11S4	1082.33	14 / 9	2.8	No
190202	CHEMBL385727	C49H63N9O11S4	1082.33	14 / 9	2.8	No
206689	CHEMBL430906	C45H56N8O13S3	1013.17	15 / 10	1.6	No
217118	CHEMBL331408	C46H50N8O13S2	987.069	14 / 11	2.2	No
231282	CHEMBL2079550	C49H59F2N9O12S2	1068.18	16 / 11	2.2	No
231284	CHEMBL2079602	C49H59F2N9O12S2	1068.18	16 / 11	2.2	No
279551	CHEMBL263155	C47H61N9O11S3	1024.24	13 / 10	1.8	No
291184	CHEMBL2370122	C47H59N9O14S3	1070.22	16 / 11	1.0	No
315342	CHEMBL273344	C47H58N8O11S2	975.146	13 / 10	2.0	No
344879	CHEMBL122438	C46H56N8O13S2	993.117	14 / 11	1.8	No
351797	CHEMBL2079603	C49H61N9O12S2	1032.2	14 / 11	1.4	No
351800	CHEMBL2079549	C49H61N9O12S2	1032.2	14 / 11	1.4	No
353331	CHEMBL433647	C43H52N8O13S2	953.052	14 / 11	1.0	No
391035	CHEMBL421471	C44H54N8O13S2	967.079	14 / 11	1.3	No
424432	CHEMBL405805	C47H52N8O13S2	1001.1	14 / 11	2.6	No
440728	CHEMBL275167	C46H56N12O9S2	985.149	14 / 10	1.7	No

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417