Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	C-C chemokine receptor type 5
Species	Macaca fascicularis (Crab-eating macaque)
Gene	CCR5
Synonym	C-C CKR-5 CC-CKR-5 CCR-5 CCR5
Disease	N/A for non-human GPCRs
Length	352
Amino acid sequence	MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKRLKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSSHFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
UniProt	P61814
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL1075263
IUPHAR	N/A
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
18451	CHEMBL58004	C30H37N5O2	499.659	5 / 0	4.2	Yes
57513	NIBR-1282	C30H37N5O2	499.659	5 / 0	3.7	Yes
64752	CHEMBL255857	C30H39N5O2S	533.735	6 / 0	4.2	No
114532	CHEMBL255645	C28H31Cl2N5O2	540.489	5 / 0	4.2	No
123901	CHEMBL255856	C30H37N5O	483.66	5 / 0	4.7	Yes
146983	CHEMBL301454	C33H41N3O	495.711	3 / 0	6.8	No
167624	CHEMBL556314	C31H38N4O2	498.671	4 / 0	4.8	Yes
167971	CHEMBL255431	C29H35N5O	469.633	5 / 0	4.6	Yes
168005	CHEMBL58387	C31H38N4O	482.672	4 / 0	5.8	No
198788	CHEMBL61424	C30H37N5O	483.66	5 / 0	5.2	No
219667	CHEMBL62152	C32H39N3O	481.684	3 / 0	6.8	No
221654	CHEMBL255644	C28H31Cl2N5O	524.49	5 / 0	5.2	No
253291	CHEMBL401929	C33H36N4O	504.678	4 / 0	6.3	No
281037	CHEMBL255646	C30H37N5O2	499.659	5 / 0	4.1	Yes
312816	CHEMBL255430	C31H38N4O	482.672	4 / 0	5.7	No
331982	CHEMBL59511	C33H39N5O2	537.708	5 / 0	4.4	No
408640	CHEMBL61536	C32H40N4O2	512.698	4 / 0	4.7	No
427685	CHEMBL255429	C31H38N4O	482.672	4 / 0	5.7	No

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417