Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Adenosine receptor A1
Species	Oryctolagus cuniculus (Rabbit)
Gene	ADORA1
Synonym	N/A
Disease	N/A for non-human GPCRs
Length	328
Amino acid sequence	MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPETYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKAVVTPRRAAVAIAGCWILSLVVGLTPMFGWNNLREVQRAWAANGSVGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRRQLSKKASASSGDPHKYYGKELKIAKSLALILFLFALSWLPLHILNCVTLFCPSCQKPSILVYTAIFLTHGNSAMNPIVYAFRIHKFRVTFLKIWNDHFRCRPAPAGDGDEDLPEEKPND
UniProt	P34970
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3947
IUPHAR	N/A
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
49482	CHEMBL3674590	C23H29N5O5	455.515	9 / 4	2.3	Yes
53518	CHEMBL3679384	C22H26FN5O5	459.478	10 / 4	2.0	Yes
53520	CHEMBL3679377	C22H26FN5O5	459.478	10 / 4	2.0	Yes
62692	CHEMBL3679388	C23H29N5O6	471.514	10 / 4	1.9	Yes
62694	CHEMBL3679381	C23H29N5O6	471.514	10 / 4	1.9	Yes
76822	8-Cyclopentyl-1,3-dipropylxanthine	C16H24N4O2	304.394	3 / 1	4.0	Yes
79288	Xanthine amine congener	C21H28N6O4	428.493	6 / 3	2.7	Yes
89152	CHEMBL3679383	C23H29N5O5	455.515	9 / 4	2.3	Yes
89153	CHEMBL3679376	C23H29N5O5	455.515	9 / 4	2.3	Yes
112748	CHEMBL3679379	C25H33N5O5	483.569	9 / 4	3.1	Yes
112750	CHEMBL3679386	C25H33N5O5	483.569	9 / 4	3.1	Yes
124388	AC1L1GG2	C18H19IN6O4	510.292	8 / 4	0.9	No
127524	CHEMBL3679387	C22H26IN5O5	567.384	9 / 4	2.6	No
127526	CHEMBL3679380	C22H26IN5O5	567.384	9 / 4	2.6	No
145766	NECA	C12H16N6O4	308.298	8 / 4	-0.7	Yes
145787	SMR000104521	C12H16N6O4	308.298	8 / 4	-0.7	Yes
153698	(+)-Abscisic acid	C15H20O4	264.321	4 / 2	1.6	Yes
154976	US8501708, 15	C23H29N5O5	455.515	9 / 4	2.3	Yes
198805	8-(p-Sulfophenyl)theophylline	C13H12N4O5S	336.322	6 / 2	1.6	Yes
234882	CHEMBL3679382	C23H28ClN5O5	489.957	9 / 4	2.4	Yes
248445	CHEMBL3679389	C24H31N5O5	469.542	9 / 4	2.7	Yes
267299	CHEMBL3679385	C22H26FN5O5	459.478	10 / 4	2.0	Yes
267301	CHEMBL3679378	C22H26FN5O5	459.478	10 / 4	2.0	Yes
294089	IABA	C17H19IN6O4	498.281	9 / 5	1.1	Yes
297126	CHEMBL274022	C19H23N5O4	385.424	8 / 4	2.0	Yes
311163	8-Cyclopentyl-1,3-dimethylxanthine	C12H16N4O2	248.286	3 / 1	1.6	Yes
320779	N6-Cyclopentyladenosine	C15H21N5O4	335.364	8 / 4	0.9	Yes
320781	n-cyclopentyl-9-pentofuranosyl-9h-purin-6-amine	C15H21N5O4	335.364	8 / 4	0.9	Yes
332230	CHEMBL3674592	C23H29N5O5	455.515	9 / 4	2.3	Yes
336089	BW-A1433	C20H22N4O4	382.42	5 / 2	3.9	Yes
336099	CID 129447	C20H22N4O4	382.42	5 / 2	3.9	Yes
399824	AC1L1BPF	C15H20ClN5O4	369.806	8 / 4	1.8	Yes
400084	CHEMBL3674589	C22H27N5O5	441.488	9 / 4	1.9	Yes
400603	N6-2-(4-Aminophenyl)ethyladenosine	C18H22N6O4	386.412	9 / 5	0.9	Yes
427521	theophylline	C7H8N4O2	180.167	3 / 1	0.0	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417