Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Atypical chemokine receptor 3
Species	Homo sapiens (Human)
Gene	ACKR3
Synonym	RDC-1 GPR159 G-protein coupled receptor RDC1 homolog G-protein coupled receptor 159 Cxcr7 CXCR-7 CXC-R7 chemokine orphan receptor 1 chemokine (C-X-C motif) receptor 7 C-X-C chemokine receptor type 7 ACKR3 [ Show all ]
Disease	Cancer Asthma
Length	362
Amino acid sequence	MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
UniProt	P25106
Protein Data Bank	N/A
GPCR-HGmod model	P25106
3D structure model	This predicted structure model is from GPCR-EXP P25106.
BioLiP	N/A
Therapeutic Target Database	T10491
ChEMBL	CHEMBL2010631
IUPHAR	80
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
533914	CHEMBL3921107	C26H30Cl2F3N3O2	544.44	6 / 2	5.4	No
533917	CHEMBL3978976	C26H32N4O2S	464.628	5 / 2	4.2	Yes
535946	CHEMBL3915132	C26H35N5O2	449.599	5 / 2	3.6	Yes
533922	CHEMBL3915468	C27H27ClF3N3O3	533.976	7 / 2	4.9	No
536039	CHEMBL3951108	C26H35N5O2	449.599	5 / 2	3.2	Yes
533931	CHEMBL3899484	C24H32N4O3	424.545	5 / 2	3.4	Yes
533935	CHEMBL3982167	C29H36N4O2	472.633	3 / 2	4.3	Yes
463830	CHEMBL3581286	C40H60N12O7	820.997	9 / 10	0.5	No
533938	CHEMBL3982702	C24H31FN4O2	426.536	5 / 2	2.7	Yes
533939	CHEMBL3923052	C26H32FN3O2	437.559	4 / 2	4.3	Yes
533941	CHEMBL3905974	C27H27Cl2N3O2	496.432	3 / 2	5.1	No
533946	CHEMBL3942036	C30H35N3O2	469.629	3 / 2	5.4	No
533947	CHEMBL3889615	C24H29F3N4O2	462.517	7 / 2	3.5	Yes
536229	CHEMBL3974763	C25H32N4O2	420.557	4 / 2	3.1	Yes
533950	CHEMBL3905756	C23H33N3O2	383.536	3 / 2	3.0	Yes
533955	CHEMBL3901696	C24H30ClN3O2	427.973	3 / 1	3.9	Yes
533959	CHEMBL3970605	C26H31ClFN3O2	472.001	4 / 2	4.9	Yes
533960	CHEMBL3948534	C25H31Cl2N3O2	476.442	3 / 2	4.5	Yes
533963	CHEMBL3957872	C24H28BrF3N4O2	541.413	7 / 2	4.2	No
533964	CHEMBL3979681	C25H31F3N4O2	476.544	7 / 2	4.0	Yes
533966	CHEMBL3983033	C25H32ClN3O2S	474.06	4 / 2	5.2	No
533971	CHEMBL3985336	C27H34ClN3O2	468.038	3 / 2	4.7	Yes
536363	CHEMBL3912367	C24H29ClFN3O2	445.963	4 / 2	3.7	Yes
464764	CHEMBL3581265	C39H51N11O6	769.908	8 / 9	0.7	No
464765	CHEMBL3581273	C39H51N11O6	769.908	8 / 9	0.7	No
464767	CHEMBL3581264	C39H51N11O6	769.908	8 / 9	0.7	No
464770	CHEMBL3581271	C39H51N11O6	769.908	8 / 9	0.7	No
464771	CHEMBL3581272	C39H51N11O6	769.908	8 / 9	0.7	No
464774	CHEMBL3581270	C39H51N11O6	769.908	8 / 9	0.7	No
533974	CHEMBL3911168	C28H37N3O2	447.623	3 / 2	4.9	Yes
533979	CHEMBL3917580	C25H31ClN4O2	454.999	4 / 2	3.7	Yes
19550	CHEMBL2013232	C28H37FN2O5	500.611	7 / 0	5.1	No
19821	CHEMBL2381324	C21H27NO4	357.45	5 / 1	3.0	Yes
536480	CHEMBL3946330	C26H33F3N4O2	490.571	7 / 2	4.4	Yes
536521	CHEMBL3961653	C26H33N3O3	435.568	4 / 2	3.1	Yes
533994	CHEMBL3963631	C25H31ClN4O2	454.999	4 / 2	3.6	Yes
534001	CHEMBL3983752	C23H29FN4O3	428.508	5 / 2	1.7	Yes
534003	CHEMBL3930062	C23H31N5O2	409.534	4 / 3	2.5	Yes
534007	CHEMBL3981571	C22H25F3N4O2	434.463	7 / 2	2.9	Yes
26135	CHEMBL2013219	C26H34N2O3	422.569	4 / 0	5.0	Yes
534011	CHEMBL3975274	C24H29FN4O2	424.52	5 / 1	2.4	Yes
534012	CHEMBL3973660	C24H29FN4O2	424.52	5 / 1	2.4	Yes
534013	CHEMBL3891911	C22H29N3O2S	399.553	4 / 1	3.3	Yes
534014	CHEMBL3944347	C23H29ClN4O3	444.96	4 / 2	2.2	Yes
534016	CHEMBL3937850	C26H34N4O2	434.584	4 / 2	3.5	Yes
534019	CHEMBL3918035	C27H33N5O2	459.594	4 / 3	3.3	Yes
534021	CHEMBL3966602	C30H41N3O2	475.677	3 / 2	5.8	No
534023	CHEMBL3971888	C23H30ClN5O2	443.976	5 / 2	2.6	Yes
534025	CHEMBL3935099	C30H42N6O2	518.706	6 / 2	3.4	No
534026	CHEMBL3922943	C23H29FN4O2	412.509	5 / 2	2.7	Yes
534028	CHEMBL3971504	C22H25FN4O2	396.466	5 / 2	2.3	Yes
466876	CHEMBL3581285	C30H47N11O6	657.777	8 / 8	-1.9	No
534040	CHEMBL3947322	C29H32ClN3O2	490.044	3 / 2	5.1	No
534041	CHEMBL3924510	C24H29F3N6O2	490.531	9 / 2	3.0	Yes
534042	CHEMBL3938037	C22H28FN3O2S	417.543	5 / 2	3.2	Yes
534043	CHEMBL3917109	C25H32N4O2	420.557	4 / 2	3.1	Yes
534048	CHEMBL3899145	C25H34N4O2	422.573	4 / 2	3.0	Yes
536889	CHEMBL3963024	C30H41N3O2	475.677	3 / 2	5.5	No
534055	CHEMBL3924230	C25H31Cl2N3O2	476.442	3 / 2	4.5	Yes
534056	CHEMBL3943089	C26H32ClN3O2	454.011	3 / 2	4.8	Yes
534058	CHEMBL3913386	C25H30Cl2N4O2	489.441	4 / 2	5.0	Yes
534059	CHEMBL3936492	C27H36N4O2	448.611	4 / 2	3.9	Yes
534069	CHEMBL3978234	C25H31F3N4O2	476.544	7 / 2	3.9	Yes
536942	CHEMBL3972572	C27H36N4O2	448.611	4 / 2	3.9	Yes
534072	CHEMBL3929887	C29H34N4O2	470.617	4 / 2	4.4	Yes
536964	CHEMBL3904295	C27H35N3O2	433.596	3 / 2	4.6	Yes
534083	CHEMBL3898127	C27H32N4O2	444.579	4 / 2	3.9	Yes
40727	CHEMBL2013233	C26H30F2N2O3	456.534	6 / 0	5.0	Yes
534092	CHEMBL3914298	C27H34ClN3O3	484.037	4 / 2	4.8	Yes
537067	CHEMBL3975469	C26H34ClN3O2	456.027	3 / 2	4.5	Yes
534093	CHEMBL3972023	C28H37N3O2	447.623	3 / 2	4.4	Yes
534094	CHEMBL3933763	C24H29F3N4O3	478.516	7 / 2	2.5	Yes
534102	CHEMBL3890801	C25H31ClN4O2	454.999	4 / 2	4.1	Yes
534107	CHEMBL3919580	C26H33F3N4O2	490.571	7 / 2	4.9	Yes
534108	CHEMBL3972507	C25H34N4O2	422.573	4 / 2	3.0	Yes
534110	CHEMBL3983113	C28H34N4O2	458.606	3 / 3	4.3	Yes
47289	CHEMBL2381337	C21H29N3OS	371.543	4 / 1	4.9	Yes
534120	CHEMBL3980568	C25H31ClN4O2	454.999	4 / 2	4.1	Yes
47860	CHEMBL2013220	C26H34N2O2	406.57	3 / 0	5.4	No
534128	CHEMBL3974670	C24H29F3N4O2	462.517	7 / 2	3.8	Yes
537223	CHEMBL3923474	C30H41N5O2	503.691	5 / 2	4.4	No
534129	CHEMBL3946666	C26H31F3N4O2	488.555	7 / 2	4.0	Yes
534141	CHEMBL3982357	C25H32FN3O3	441.547	5 / 2	3.4	Yes
534143	CHEMBL3911655	C21H24ClN3O2	385.892	3 / 2	3.0	Yes
534146	CHEMBL3947371	C25H33N3O2S	439.618	4 / 1	4.4	Yes
534147	CHEMBL3986916	C25H34N4O2	422.573	4 / 2	3.0	Yes
534148	CHEMBL3902012	C29H34N4O2	470.617	4 / 2	4.7	Yes
534151	CHEMBL3905718	C23H26FN3O2	395.478	4 / 2	3.0	Yes
534155	CHEMBL3899041	C23H28N4O2	392.503	4 / 2	2.2	Yes
534156	CHEMBL3935694	C29H39N5O2	489.664	5 / 2	4.0	Yes
534161	CHEMBL3925733	C28H37N3O2	447.623	3 / 2	5.0	Yes
534163	CHEMBL3942373	C26H34N4O2	434.584	4 / 2	3.5	Yes
537411	CHEMBL3984153	C26H33ClN4O2	469.026	4 / 2	4.5	Yes
534174	CHEMBL3966751	C25H28ClF3N4O2	508.97	7 / 2	4.4	No
534175	CHEMBL3957834	C24H29FN4O2	424.52	5 / 2	2.7	Yes
534178	CHEMBL3968214	C29H41N5O2	491.68	5 / 2	4.3	Yes
534182	CHEMBL3956018	C27H34FN3O2	451.586	4 / 2	4.6	Yes
534185	CHEMBL3922915	C28H37N3O2	447.623	3 / 2	4.9	Yes
534186	CHEMBL3982018	C25H31F3N4O3	492.543	7 / 2	3.1	Yes
63141	CHEMBL2013223	C26H32F2N2O3	458.55	6 / 0	5.2	No

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417