Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Alpha-1B adrenergic receptor
Species	Rattus norvegicus (Rat)
Gene	Adra1b
Synonym	adrenergic receptor alpha 1B-adrenoceptor alpha 1B-adrenoreceptor adrenergic alpha 1B receptor Alpha-1B adrenoceptor Alpha-1B adrenoreceptor alpha1B-adrenergic receptor alpha1B-adrenoceptor [ Show all ]
Disease	N/A for non-human GPCRs
Length	515
Amino acid sequence	MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGTQRTLPSASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGDPESPGTEGDTSNGGCDTTTDLANGQPGFKSNMPLAPGHF
UniProt	P15823
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL315
IUPHAR	23
DrugBank	N/A

Ligand

Name	lipoic acid
Molecular formula	C8H14O2S2
IUPAC name	5-[(3R)-dithiolan-3-yl]pentanoic acid
Molecular weight	206.318
Hydrogen bond acceptor	4
Hydrogen bond donor	1
XlogP	1.7
Synonyms	(R)-(+)-alpha-Lipoic acid, analytical standard LMFA01130001 (R)-alpha-Lipoic acid NCGC00094396-01 1,2-Dithiolane-3-pentanoic acid; 5-(1,2-Dithiolan-3-yl)valeric acid R-(+)-alpha-Lipoic acid 62-46-4 SCHEMBL7924 ACT02368 Thioctic acid, d form ANW-43728 TR-003330 C16241 D-Thioctic acid ( inverted question mark)-1,2-Dithiolane-3-pentanoic acid GK0418 (R)-( )-\|A-Lipoic acid J-004243 KSC489O5H (R)-1,2-Dithiolane-3-pentanoic acid LP01129 (S)-1,2-Dithiolane-3-pentanoic acid NCGC00094396-04 5-[(3R)-1,2-dithiolan-3-yl]pentanoic acid R-alpha-Lipoic acid AB09328 SR-01000076163-1 AK-68233 Tiobec AX8017749 VLL71EBS9Z DB00166 (+)-a-Lipoic acid Heparlipon (R)-(+)-1,2-Dithiolane-3-pentanoic acid, 97% Lipoec (R)-6,8-DITHIOOCTANOIC ACID MFCD01631142 1,2-Dithiolane-3-pentanoic acid, (3R)- Q-201824 R-Lipoic acid AC-8133 Thioctanoic acid alpha-Liponsaure TL8004155 BR-68233 CS-5076 EU-0101129 (3R)-1,2-Dithiolane-3-pentanoic Acid I04-0855 (r)-(+)-alpha-lipoic acid (R)-(+)-Lipoate Lopac0_001129 (R)-lipoic acid NCGC00094396-02 1,2-Dithiolane-3R-pentanoic acid R-(+)-Lipoic acid A804416 SLA AGBQKNBQESQNJD-SSDOTTSWSA-N Thioderm API0004024 UNII-73Y7P0K73Y component AGBQKNBQESQNJD-SSDOTTSWSA-N CCG-205204 D02EVF ( inverted question mark)-alpha-Lipoic Acid GTPL4822 (R)-(+)--Lipoic acid KB-02702 L0207 (R)-1,2-Dithiolane-3-valeric Acid M-2153 (y)-alpha-Lipoic Acid NCGC00094396-05 5-[(3R)-3-dithiolanyl]pentanoic acid R-LA AB1009443 ST24026437 AKOS015892879 Tiobec Retard BDBM50106731 ZINC1544807 CHEMBL134342 DTXSID20152651 (+)-alpha-Lipoic acid HMS3263B19 (R)-(+)-1,2-Dithiolane-3-pentanoicacid (R)-(+)-alpha-Lipoic acid, >=98.0% (HPLC) (R)-6,8-thioctic acid MolPort-002-520-478 1,2-Dithiolane-3-pentanoic acid, (R)- R-(+)-1,2-Dithiolane-3-pentanoic acid 57828-26-9 RTR-003330 AC1L1LTX Thioctic acid d-form AN-8308 Tox21_501129 Byodinoral 300 CTK3I9753 FT-0670812 (?)-alpha-Lipoic Acid INV-144 (R)-(+)-lipoic acid Losartan/thioctic acid (R)-Thioctic Acid NCGC00094396-03 1200-22-2 R-(+)-Thioctic acid AB0008544 SR-01000076163 AJ-26871 Thiogamma AS-11009 UNII-VLL71EBS9Z CHEBI:30314 D05YSU (+)-1,2-Dithiolane-3-valeric Acid H452 (R)-(+)-1,2-Dithiolane-3-pentanoic acid KS-00000UQB lipoate (R)-5-(1,2-Dithiolan-3-yl)pentanoic acid MCULE-3939318333 .alpha.-Lipoic acid NCGC00261814-01 5-[(3R)-dithiolan-3-yl]pentanoic acid R-Lipoate AC-11124 T 5625 alpha-(+)-Lipoic acid Tioctic Acid Berlition CL-007 EBD2198043 (+/-)-alpha-Lipoic acid HY-18733 (R)-(+)-a-Lipoic acid [ Show all ]
Inchi Key	AGBQKNBQESQNJD-SSDOTTSWSA-N
Inchi ID	InChI=1S/C8H14O2S2/c9-8(10)4-2-1-3-7-5-6-11-12-7/h7H,1-6H2,(H,9,10)/t7-/m1/s1
PubChem CID	6112
ChEMBL	CHEMBL134342
IUPHAR	N/A
BindingDB	50106731
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Kd	<10000.0 nM	PMID15633998	BindingDB,ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417