Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	Pecazine
Molecular formula	C19H22N2S
IUPAC name	10-[(1-methylpiperidin-3-yl)methyl]phenothiazine
Molecular weight	310.459
Hydrogen bond acceptor	3
Hydrogen bond donor	0
XlogP	5.6
Synonyms	CBHCDHNUZWWAPP-UHFFFAOYSA-N DSSTox_RID_81408 mepasin MPMP Pacatal Base Pecazinum STK386548 1'-{[2-methyl-3-(morpholin-4-ylcarbonyl)-4H-thieno[3,2-b]pyrrol-5-yl]carbonyl}-1,4'-bipiperidine 10-[(1-methylpiperidin-3-yl)methyl]phenothiazine AI3-50131 BAS 01176610 GTPL9782 Mepazine Base Nothiazine Pecatal Phenothiazine, 10-[(1-methyl-3-piperidyl)methyl]- 10-(1-Methyl-piperidin-3-ylmethyl)-10H-phenothiazine 2975-36-2 (mono-hydrochloride) CAS-60-89-9 DSSTox_CID_26177 LS-105610 MLS006011657 P 391 SCHEMBL149976 10-[(1-Methyl-3-piperidyl)-methyl]-phenothiazin AC1L1LQX CCG-108581 DTXSID2046177 Mepazin NCGC00160480-01 Pacatol Pecazinum [INN-Latin] Tox21_111842 10-((1-Methyl-3-piperidyl)methyl)phenothiazine 10H-Phenothiazine, 10-((1-methyl-3-piperidinyl)methyl)- AKOS000280691 BDBM50177661 CHEMBL395110 III-2318 Meprazine Oprea1_067080 Pecazina Probes1_000237 10-(1-Methylpiperidyl-3-methyl)phenothiazine 60-89-9 CBDivE_007551 DSSTox_GSID_46177 MCULE-4399173403 MolPort-001-727-944 Pacatal Pecazine [INN:BAN] SMR004703409 (N-Methyl-3-piperidyl)methylphenothiazine 10-[(1-Methyl-3-piperidyl)methyl]phenothiazine AC1Q7G4S CHEBI:135324 EINECS 200-490-8 MEPAZINE NCIOpen2_008134 Pakatal Phenothiazine, 10-((1-methyl-3-piperidyl)methyl)- US9504692, Mepezine 10-(1-Methyl-3-piperidyl)methyl phenothiazine 10H-Phenothiazine, 10-[(1-methyl-3-piperidinyl)methyl]- AKOS021820849 BRD-A82772293-001-01-6 CTK1A4018 Lacumin Mesapin Oprea1_208564 Pecazina [INN-Spanish] Probes2_000278 10-[(1-Methyl-3-piperidinyl)methyl]-10H-phenothiazine # AB00275848-07 [ Show all ]
Inchi Key	CBHCDHNUZWWAPP-UHFFFAOYSA-N
Inchi ID	InChI=1S/C19H22N2S/c1-20-12-6-7-15(13-20)14-21-16-8-2-4-10-18(16)22-19-11-5-3-9-17(19)21/h2-5,8-11,15H,6-7,12-14H2,1H3
PubChem CID	6075
ChEMBL	CHEMBL395110
IUPHAR	N/A
BindingDB	N/A
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand has a partition coefficient log P greater than 5.

Experimental Data

Parameter	Value	Reference	Database source
Activity	29.0 %	PMID17407813	ChEMBL
IC50	495.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL
Ki	259.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417