Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	Phentolamine mesylate
Molecular formula	C18H23N3O4S
IUPAC name	3-[N-(4,5-dihydro-1H-imidazol-2-ylmethyl)-4-methylanilino]phenol;methanesulfonic acid
Molecular weight	377.459
Hydrogen bond acceptor	6
Hydrogen bond donor	3
XlogP	None
Synonyms	SMR000059054 AS-13800 Vasomax CHEMBL1200873 FT-0603267 K062 MLS000069487 Opera_ID_1599 Phentolamine mesilate (JAN/INN) 134P201 Phentolamine mesylate [USP] 3-[N-(4,5-dihydro-1H-imidazol-2-ylmethyl)-4-methylanilino]phenol; methanesulfonic acid Regitin mesylate A828197 AB2000443 ST057364 C17H19N3O.CH4O3S Y7543E5K9T CTK8G2357 HMS3373D03 LP00982 NCGC00016195-01 P1985 Phentolamine mesilate, British Pharmacopoeia (BP) Reference Standard 3-(((4,5-dihydro-1H-imidazol-2-yl)methyl)(p-tolyl)amino)phenol methanesulfonate Phentolamine methanesulfonate 3-[[(4,5-Dihydro-1H-imidazol-2-yl)methyl](4-methylphenyl)-amino]phenol mesylate Regitine mesylate SAM002703130 AKOS007930193 UNII-Y7543E5K9T CCRIS 9022 EINECS 200-604-6 I14-0396 MCULE-3770473461 NCGC00261667-01 Phentolamine (mesylate) 3-[N-(2-Imidazolin-2-ylmethyl)-p-toluidino]phenol methanesulphonate Phentolamine methanesulphonate 50-60-2 (Parent) SR-01000000055 BC200362 VZ33629 CPD000059054 HMS2233A24 KS-00000XQY MLS001076484 OraVerse Phentolamine mesilate for system suitability, European Pharmacopoeia (EP) Reference Standard 2-[N-(m-Hydroxyphenyl)-p-toluidinomethyl]imidazoline Methanesulfonate Phentolamine Mesylate, Pharmaceutical Secondary Standard; Certified Reference Material 3-[N-(4,5-dihydro-1H-imidazol-2-ylmethyl)-4-methylanilino]phenol;methanesulfonic acid Regitin methanesulphonate A835046 AC-7472 SW196637-3 C18H23N3O4S Z-Max D00509 HMS3655B13 LS-104726 NCGC00016195-02 Phenol, 3-(((4,5-dihydro-1H-imidazol-2-yl)methyl)(4-methylphenyl)amino)-, monomethanesulfonate (salt) Phentolamine mesilate, European Pharmacopoeia (EP) Reference Standard 3-[(2-imidazolin-2-ylmethyl)(4-methylphenyl)amino]phenol, methanesulfonic acid Phentolamine methanesulfonate salt 3-[[(4,5-Dihydro-1H-imidazol-2-yl)methyl](4-methylphenyl)amino]phenol methanesulfonate Regitine methanesulfonate SCHEMBL40852 AN-8957 Vasofem EU-0100982 J10339 MFCD00134201 NV-101 phentolamine mesilate Phentolamine mesylate (USP) 3-[N-(4,5-dihydro-1H-imidazol-2-ylmethyl)-4-methyl-anilino]phenol; methanesulfonic acid REGID_for_CID_91430 65-28-1 SR-01000000055-3 BCP09845 W-104799 CS-2419 HMS3263E05 Lopac-P-7561 MolPort-003-959-154 P 7561 Phentolamine mesilate [INN:BAN] 2-[N-(m-Hydroxyphenyl)-p-toluidinomethyl]imidazoline, methanesulfonate Phentolamine mesylate, United States Pharmacopeia (USP) Reference Standard 3-[[(4,5-Dihydro-1H-imidazol-2- yl)methyl](4-methylphenyl)-amino]phenol mesylate Regitine (TN) AB0014005 AC1L3M27 Tox21_500982 CCG-222286 DTXSID60215315 HY-B0362A m-(N-(2-Imidazolin-2-ylmethyl)-p-toluidino)phenol monomethanesulfonate (salt) NCGC00094282-01 Phenol, m-(N-(2-imidazolin-2-ylmethyl)-p-toluidino)-, monomethanesulfonate (salt) Phentolamine Meslate,(S) 3-[4,5-dihydro-1H-imidazol-2-ylmethyl-(4-methylphenyl)amino]phenol; methanesulfonic acid Phentolamine methanesulfonate salt, >=98% (TLC), powder 4CA-1013 s2038 [ Show all ]
Inchi Key	OGIYDFVHFQEFKQ-UHFFFAOYSA-N
Inchi ID	InChI=1S/C17H19N3O.CH4O3S/c1-13-5-7-14(8-6-13)20(12-17-18-9-10-19-17)15-3-2-4-16(21)11-15;1-5(2,3)4/h2-8,11,21H,9-10,12H2,1H3,(H,18,19);1H3,(H,2,3,4)
PubChem CID	91430
ChEMBL	CHEMBL1200873
IUPHAR	N/A
BindingDB	N/A
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	Partition coefficient log P of this ligand is not available.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	PMID9686407	PDSP

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417