BioLiP

>protein
YVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYG
CLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRE
LTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK

The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2xoy:B	214	213	1.0000	0.9907	0.9953	2.51e-158	2xoc:A, 2xoc:B, 2xoy:A, 2xoz:A, 2xoz:B, 2xp0:A, 2xp0:B
2	2i22:B	178	73	0.1085	0.1292	0.3151	0.018	2i22:C
3	7veo:B	255	115	0.1085	0.0902	0.2000	0.68
4	8q4h:A	503	62	0.0802	0.0338	0.2742	1.3	8q4h:B
5	7mxb:A	672	79	0.1085	0.0342	0.2911	2.6	7mxb:B, 7mxj:A, 7mxk:A
6	2ob0:C	166	21	0.0566	0.0723	0.5714	2.7	2ob0:A, 2ob0:B, 6ppl:A, 2psw:A, 2psw:B, 2psw:C, 3tfy:A, 3tfy:B, 3tfy:C, 6wf3:A, 6wf3:B, 6wf3:C, 6wf3:D, 6wf3:E, 6wf3:F, 6wf5:A, 6wf5:B, 6wfg:A, 6wfg:C, 6wfg:E, 6wfk:A, 6wfk:B, 6wfk:C, 6wfn:A, 6wfo:A, 6wfo:B, 6wfo:C, 4x5k:A
7	6i71:A	353	93	0.1132	0.0680	0.2581	4.8	6i71:B, 6i72:A, 6i72:B, 6i73:A, 6i73:B, 6yjw:A, 6yjw:B
8	1hyo:B	419	94	0.1085	0.0549	0.2447	6.4	1hyo:A, 2hzy:A, 2hzy:B, 1qcn:A, 1qcn:B, 1qco:A, 1qco:B, 1qqj:A, 1qqj:B
9	5li1:A	334	56	0.0708	0.0449	0.2679	9.2	3a8w:A, 3a8w:B, 4dc2:A, 6ilz:A, 6ilz:C, 6ilz:E, 6ilz:G, 5li9:A, 5lih:A, 5lih:B, 3zh8:A, 3zh8:B, 3zh8:C, 1zrz:A

[Back]