YVNNKELLQAIIDWKTELANVRQNDTIGLAIMLIAEGLSKRFNFSGYTQSWKQEMIADGIEASIKGLHNFDETKYKNPHA
YITQACFNAFVQRIKKERKEVAKKYSYFVHNVYDSRDDDMVALVDETFIQDIYDKMT
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d7c:F | 137 | 137 | 1.0000 | 1.0000 | 1.0000 | 2.54e-101 | 7d7d:F |
2 | 3faw:A | 775 | 18 | 0.0730 | 0.0129 | 0.5556 | 1.9 | 3fax:A |
3 | 6cxh:B | 241 | 41 | 0.0876 | 0.0498 | 0.2927 | 2.5 | 7s4l:B, 7s4l:G, 7s4l:F |
4 | 3ksm:A | 276 | 32 | 0.0803 | 0.0399 | 0.3438 | 5.5 | 3ksm:B |
5 | 8j4h:A | 309 | 66 | 0.1533 | 0.0680 | 0.3182 | 5.6 | 8j4j:A |
6 | 8dzv:A | 235 | 50 | 0.1095 | 0.0638 | 0.3000 | 5.8 |