Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
YVFEDVVRIYDTDAQGIAHYAAYYRFFTNTIEKFIKEKVGIPYPIVNENLWFVIAESHAIYHRPVKLGDKLTVLLNPKIL
SNKTIKFEFKVLKDGELTTEGYVIQIAINPKIWKSTEMPKEIMDK

The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2gf6:A 134 125 1.0000 0.9328 1.0000 8.52e-90 2gf6:B, 2gf6:C, 2gf6:D
2 5kl9:A 134 120 0.2240 0.2090 0.2333 1.58e-07 5kl9:D, 5t06:A, 5t06:C, 5t07:A, 5t07:D, 5t07:B, 5t07:C
3 2cye:C 133 74 0.1440 0.1353 0.2432 0.028 2cye:A, 2cye:B, 2cye:D
4 5eo2:C 158 117 0.2320 0.1835 0.2479 0.11 5eo2:B, 5eo2:E, 5eo2:F
5 5hmc:A 125 73 0.1520 0.1520 0.2603 0.41
6 5aed:A 674 32 0.1040 0.0193 0.4062 1.2 5aed:B, 5aee:A, 5aee:B, 5aeg:A, 5aeg:B, 5oht:A, 5oht:B
7 8a3w:R 178 38 0.1040 0.0730 0.3421 3.9 8a98:R, 6az3:R, 3jcs:R, 8ovj:R, 8rxh:LR, 8rxx:LR, 5t2a:Q
8 7yes:A 1369 84 0.1760 0.0161 0.2619 6.4 8jsl:A, 8jsm:A, 8jsn:A, 7yer:A
9 7yet:A 999 84 0.1760 0.0220 0.2619 6.5
10 4ii9:A 337 63 0.1200 0.0445 0.2381 9.3 3gkr:A, 1ne9:A, 1p4n:A, 1xe4:A, 1xf8:A, 7z5y:A, 7z5z:A, 7z6a:A, 7z6k:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218