YSIEKLKKEENSLAKDYYIYRLLEKNKISKKDAQDLNSHIFRYIGKIKSELEKIIPLKPYINPKYAKCYTYTANTILDAN
LTCQSVRLNSLVFIASLNSKDRTTLAQTFKNQRPDLTNLLLAFNTSDPMSYIVQKEDINGFFKLYNYSKKYDLDLNTSLV
NKLPNHIGFKDFAQNIIIKKENPKFRHSMLEINPENVSEDSAFYLGVNALTYDKTELAYDFFKKAAQSFKSQSNKDNAIF
WMWLIKNNEEDLKTLSQSSSLNIYSLYAKELTNTPFPKIESLNPSKKKNNFNMQDPFAWQKINKQIRDANASQLDVLAKE
FDTQETLPIYAYILERKNNFKKHYFIMPYYDNIKDYNKTRQALILAIARQESRFIPTAISVSYALGMMQFMPFLANHIGE
KELKIPNFDQDFMFKPEIAYYFGNYHLNYLESRLKSPLFVAYAYNGGIGFTNRMLARNDMFKTGKFEPFLSMELVPYQES
RIYGKKVLANYIVYRHLLNDSIKISDIFENLI
The query sequence (length=512) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8gfp:A | 516 | 512 | 1.0000 | 0.9922 | 1.0000 | 0.0 | 6cfc:A, 8gez:A, 8gf0:A, 8gf1:A, 8gfb:A, 8gfc:A, 8gfd:A, 8gfe:A, 8gff:A, 8gfg:A, 8gfh:A, 8gfi:A, 8gfl:A, 8gfm:A, 8gfq:A, 8gfs:A |
2 | 1sly:A | 618 | 179 | 0.1055 | 0.0874 | 0.3017 | 6.54e-13 | |
3 | 5o1j:A | 580 | 169 | 0.0977 | 0.0862 | 0.2959 | 1.20e-09 | 5mpq:A |
4 | 6fcq:A | 613 | 151 | 0.0859 | 0.0718 | 0.2914 | 1.53e-08 | 6fbt:A, 6fcr:A, 6fcs:A, 6fcu:A |
5 | 4cfo:A | 327 | 105 | 0.0645 | 0.1009 | 0.3143 | 3.86e-04 | 4cfo:B, 4cfp:A, 4cfp:B, 4chx:A |
6 | 8rhf:B | 327 | 124 | 0.0723 | 0.1131 | 0.2984 | 0.035 | 8rhe:A, 8rhe:B, 8rhf:A, 8rhi:A, 8rhi:B |
7 | 7el9:A | 1731 | 86 | 0.0430 | 0.0127 | 0.2558 | 1.5 | 7el9:D, 7elc:A |
8 | 7elb:A | 1937 | 86 | 0.0430 | 0.0114 | 0.2558 | 1.6 | 7ckm:A, 7elb:C, 6kld:A, 6kle:A, 6klh:A, 6klh:C |
9 | 5wyj:CB | 1098 | 142 | 0.0762 | 0.0355 | 0.2746 | 4.9 | 7ajt:UV, 7aju:UV, 7d4i:RE, 7d5s:RE, 7d5t:RE, 7d63:RE, 6ke6:RE, 6lqp:RE, 6lqq:RE, 6lqr:RE, 6lqs:RE, 6lqt:RE, 6lqu:RE, 7suk:NH, 5wyk:CB, 6zqb:UV, 6zqc:UV, 6zqd:UV, 6zqe:UV |
10 | 5n1j:A | 206 | 76 | 0.0352 | 0.0874 | 0.2368 | 6.4 | 5n1j:B, 5n1j:C, 5n1j:D, 5n1p:A, 5n1p:D, 5n1p:B, 5n1p:C, 5nc6:A, 5nc6:B, 5nc6:C, 5nc6:D, 5nc9:A, 5nc9:B, 5nc9:C, 5nc9:D, 5ncd:A, 5ncd:B, 5ncd:C, 5ncd:D, 5nek:A, 5nek:B, 5nek:C, 5nek:D, 5nel:A, 5nel:B, 5nel:C, 5nel:D |
11 | 5yvg:B | 764 | 50 | 0.0273 | 0.0183 | 0.2800 | 9.6 |