YSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNP
The query sequence (length=489) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8bh3:B |
507 |
503 |
1.0000 |
0.9645 |
0.9722 |
0.0 |
8asc:A, 8asc:E, 8asc:K, 8asc:O, 8bh3:T, 8bhv:a, 8bhv:h, 8bhy:B, 8bhy:T, 8bot:G, 8bot:T, 6erf:A, 6erf:G, 6erg:A, 6erg:D, 6erh:A, 6erh:C, 8eza:A, 8eza:J, 8ezb:A, 8ezb:J, 1jey:A, 7k1j:B, 7lsy:A, 7lsy:J, 7lt3:A, 7lt3:J, 7nfc:B, 7nfc:G, 7sgl:B, 7su3:B, 5y3r:A, 7z6o:A, 7z87:B, 7z88:B, 6zha:B, 6zhe:G, 6zhe:B, 7zvt:A, 7zwa:A, 7zyg:A |
2 |
7nfe:B |
475 |
489 |
0.9714 |
1.0000 |
0.9714 |
0.0 |
8bot:B |
3 |
5y58:A |
548 |
504 |
0.2229 |
0.1989 |
0.2163 |
2.39e-07 |
5y58:E, 5y58:C |
4 |
5y58:B |
568 |
131 |
0.0736 |
0.0634 |
0.2748 |
0.014 |
5y58:D, 5y58:F, 5y59:B |
5 |
6tyw:A |
218 |
81 |
0.0409 |
0.0917 |
0.2469 |
1.1 |
6tyt:A, 6tyu:A, 6tyv:A, 6tyx:A, 6tyx:B, 6tyz:A |
6 |
1jx0:A |
217 |
46 |
0.0348 |
0.0783 |
0.3696 |
2.1 |
1eyq:A, 1eyq:B, 1fm7:A, 1fm7:B, 1fm8:A, 1jep:A, 1jep:B, 1jx1:C |
7 |
8g1e:A |
1037 |
129 |
0.0675 |
0.0318 |
0.2558 |
3.7 |
8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D |
8 |
7yfl:A |
708 |
58 |
0.0368 |
0.0254 |
0.3103 |
4.7 |
7yfl:C |
9 |
5txe:A |
652 |
27 |
0.0266 |
0.0199 |
0.4815 |
8.6 |
5txe:B |