YRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMA
The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3zwh:Q | 43 | 43 | 1.0000 | 1.0000 | 1.0000 | 5.73e-26 | |
2 | 8bsi:a | 815 | 36 | 0.3256 | 0.0172 | 0.3889 | 0.75 | |
3 | 1jhd:A | 396 | 25 | 0.2558 | 0.0278 | 0.4400 | 3.3 | |
4 | 3r2l:A | 154 | 30 | 0.2558 | 0.0714 | 0.3667 | 5.5 | 3r2m:A, 3r2r:A, 3r2s:A |
5 | 3hsk:A | 358 | 18 | 0.2326 | 0.0279 | 0.5556 | 5.7 | |
6 | 4y3o:B | 461 | 28 | 0.2791 | 0.0260 | 0.4286 | 6.4 | 4cck:A, 4cck:B, 4cck:C, 4cck:D, 4ccm:A, 4ccm:B, 4ccn:A, 4ccn:B, 4cco:A, 4cco:B, 4diq:A, 4diq:B, 4e4h:A, 4e4h:B, 4e4h:C, 4e4h:D, 4y3o:A |
7 | 6rim:F | 458 | 25 | 0.2326 | 0.0218 | 0.4000 | 7.2 | 6rim:A, 6rim:B, 6rim:C, 6rim:D, 6rim:E, 6rim:G, 6rim:H |
8 | 3na7:A | 237 | 30 | 0.2558 | 0.0464 | 0.3667 | 7.8 | |
9 | 7a7b:G | 265 | 22 | 0.2558 | 0.0415 | 0.5000 | 8.9 | |
10 | 7apr:G | 293 | 22 | 0.2558 | 0.0375 | 0.5000 | 8.9 | |
11 | 7a7b:A | 323 | 22 | 0.2558 | 0.0341 | 0.5000 | 8.9 | 7a7b:B, 7a7b:C, 7a7b:D, 7a7b:E, 7a7b:F, 7a7b:H, 7apr:A, 7apr:B, 7apr:C, 7apr:D, 7apr:E, 7apr:F, 7apr:H |