YRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFEKWQAS
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4mbe:E | 51 | 50 | 1.0000 | 0.9804 | 1.0000 | 1.68e-31 | 4c31:A, 4c31:D, 4mbe:B |
2 | 1xzq:A | 449 | 26 | 0.2000 | 0.0223 | 0.3846 | 4.5 | 1xzq:B |
3 | 4x8b:A | 428 | 36 | 0.2200 | 0.0257 | 0.3056 | 4.6 | 4x8b:B, 4x8d:A, 4x8d:B, 4x8e:A, 4x8e:B |
4 | 7e0d:A | 604 | 26 | 0.2400 | 0.0199 | 0.4615 | 9.3 | 7e0c:A, 2e1m:A, 2e1m:B, 2e1m:C, 8jpw:A |