>protein
YRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLR
VQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERREKEQADKDRRARLQAE
The query sequence (length=135) is searched through a non-redundant set of database sequences
protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
6gaw:Bv |
135 |
135 |
1.0000 |
1.0000 |
1.0000 |
8.63e-92 |
5aj4:Bv, 6gb2:Bv, 7nqh:Bv, 7nql:Bv, 7nsh:Bv, 7nsi:Bv, 7nsj:Bv, 8oin:Bg, 8oiq:Bg, 6ydp:Bv, 6ydw:Bv |
| 2 |
7l08:q |
168 |
117 |
0.7185 |
0.5774 |
0.8291 |
3.73e-53 |
7a5f:q3, 7a5g:q3, 7a5i:q3, 7a5j:q, 7a5k:q3, 8any:q, 6i9r:q, 8k2a:L8, 8k2b:L8, 7l20:q, 6nu2:q, 6nu3:q, 7o9k:q, 7o9m:q, 7odr:q, 7ods:q, 7odt:q, 7of0:q, 7of2:q, 7of3:q, 7of4:q, 7of5:q, 7of6:q, 7of7:q, 7og4:q, 7oi8:q, 7oia:q, 7oic:q, 7oid:q, 8oir:Bg, 8oit:Bg, 8pk0:q, 7po4:q, 7qh6:q, 7qh7:q, 7qi4:q, 7qi5:q, 7qi6:q, 8qsj:q, 6vlz:q, 6vmi:q, 8xt0:L8, 8xt1:L8, 8xt2:L8, 8xt3:L8, 6zm5:q, 6zm6:q, 6zs9:q, 6zsa:q, 6zsb:q, 6zsc:q, 6zsd:q, 6zse:q, 6zsg:q |
| 3 |
8a22:AJ |
122 |
27 |
0.0815 |
0.0902 |
0.4074 |
1.1 |
8apn:AJ, 8apo:AJ |
| 4 |
1nf8:A |
207 |
102 |
0.1926 |
0.1256 |
0.2549 |
3.1 |
|
| 5 |
5f6d:A |
156 |
42 |
0.0815 |
0.0705 |
0.2619 |
3.6 |
5f6u:A, 5f6v:A, 5f6w:A, 5f6x:A, 5f6y:A, 6syf:A, 6syf:B, 6syf:C, 6syf:D |
| 6 |
3wx7:A |
402 |
24 |
0.0667 |
0.0224 |
0.3750 |
6.3 |
3wx7:B |
| 7 |
5wph:A |
179 |
41 |
0.1185 |
0.0894 |
0.3902 |
9.3 |
6m7g:A, 6m7g:C, 6m7g:B, 6m7g:D, 6m7g:E, 6m7g:F, 6m7g:L, 5wph:B |
[Back]
umich.edu