YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLR
The query sequence (length=168) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7l08:q |
168 |
168 |
1.0000 |
1.0000 |
1.0000 |
1.35e-117 |
7a5f:q3, 7a5g:q3, 7a5i:q3, 7a5j:q, 7a5k:q3, 8any:q, 6i9r:q, 8k2a:L8, 8k2b:L8, 7l20:q, 6nu2:q, 6nu3:q, 7o9k:q, 7o9m:q, 7odr:q, 7ods:q, 7odt:q, 7of0:q, 7of2:q, 7of3:q, 7of4:q, 7of5:q, 7of6:q, 7of7:q, 7og4:q, 7oi8:q, 7oia:q, 7oic:q, 7oid:q, 8oir:Bg, 8oit:Bg, 8pk0:q, 7po4:q, 7qh6:q, 7qh7:q, 7qi4:q, 7qi5:q, 7qi6:q, 8qsj:q, 6vlz:q, 6vmi:q, 8xt0:L8, 8xt1:L8, 8xt2:L8, 8xt3:L8, 6zm5:q, 6zm6:q, 6zs9:q, 6zsa:q, 6zsb:q, 6zsc:q, 6zsd:q, 6zse:q, 6zsg:q |
2 |
6gaw:Bv |
135 |
135 |
0.6667 |
0.8296 |
0.8296 |
2.38e-64 |
5aj4:Bv, 6gb2:Bv, 7nqh:Bv, 7nql:Bv, 7nsh:Bv, 7nsi:Bv, 7nsj:Bv, 8oin:Bg, 8oiq:Bg, 6ydp:Bv, 6ydw:Bv |
3 |
8a22:AJ |
122 |
34 |
0.0714 |
0.0984 |
0.3529 |
0.041 |
8apn:AJ, 8apo:AJ |
4 |
7pkt:J |
114 |
29 |
0.0536 |
0.0789 |
0.3103 |
1.8 |
|
5 |
1bmo:A |
233 |
60 |
0.1190 |
0.0858 |
0.3333 |
5.4 |
1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A |
6 |
7l08:V |
206 |
37 |
0.0774 |
0.0631 |
0.3514 |
6.3 |
7a5f:V3, 7a5g:V3, 7a5h:V, 7a5i:V3, 7a5j:V, 7a5k:V3, 8any:V, 6i9r:V, 3j7y:V, 3j9m:V, 8k2a:LX, 8k2b:LX, 7l20:V, 6nu2:V, 6nu3:V, 7o9k:V, 7o9m:V, 7odr:V, 7ods:V, 7odt:V, 7of2:V, 7of3:V, 7of4:V, 7of5:V, 7of6:V, 7og4:XV, 7oi7:V, 7oi8:V, 7oi9:V, 7oia:V, 7oib:V, 7oic:V, 7oid:V, 7oie:V, 8oir:BC, 8oit:BC, 5ool:V, 5oom:V, 7pd3:V, 8pk0:V, 7po4:V, 7qi4:V, 7qi5:V, 7qi6:V, 8qsj:V, 8qu1:V, 8qu5:V, 6vlz:V, 6vmi:V, 8xt0:LX, 8xt1:LX, 8xt2:LX, 8xt3:LX, 6zm5:V, 6zm6:V, 6zs9:XV, 6zsa:XV, 6zsb:XV, 6zsc:XV, 6zsd:XV, 6zse:XV, 6zsg:XV |
7 |
4nyu:A |
406 |
31 |
0.0774 |
0.0320 |
0.4194 |
7.7 |
4ny2:A, 4ny2:B, 4nyy:A, 4nyy:B, 4nyy:C, 4nyy:D, 4nz1:A, 4nz1:B, 4nz3:A, 4nz3:B, 4nz4:A, 4nz4:B, 4oui:A, 4oui:B |