BioLiP

>protein
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLR
VKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEK
KERKRL

The query sequence (length=166) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7l08:q	168	166	1.0000	0.9881	1.0000	3.13e-116	7a5f:q3, 7a5g:q3, 7a5i:q3, 7a5j:q, 7a5k:q3, 8any:q, 6i9r:q, 8k2a:L8, 8k2b:L8, 7l20:q, 6nu2:q, 6nu3:q, 7o9k:q, 7o9m:q, 7odr:q, 7ods:q, 7odt:q, 7of0:q, 7of2:q, 7of3:q, 7of4:q, 7of5:q, 7of6:q, 7of7:q, 7og4:q, 7oi8:q, 7oia:q, 7oic:q, 7oid:q, 8oir:Bg, 8oit:Bg, 8pk0:q, 7po4:q, 7qh6:q, 7qh7:q, 7qi4:q, 7qi5:q, 7qi6:q, 8qsj:q, 6vlz:q, 6vmi:q, 8xt0:L8, 8xt1:L8, 8xt2:L8, 8xt3:L8, 6zm5:q, 6zm6:q, 6zs9:q, 6zsa:q, 6zsb:q, 6zsc:q, 6zsd:q, 6zse:q, 6zsg:q
2	6gaw:Bv	135	135	0.6747	0.8296	0.8296	2.18e-64	5aj4:Bv, 6gb2:Bv, 7nqh:Bv, 7nql:Bv, 7nsh:Bv, 7nsi:Bv, 7nsj:Bv, 8oin:Bg, 8oiq:Bg, 6ydp:Bv, 6ydw:Bv
3	8a22:AJ	122	34	0.0723	0.0984	0.3529	0.036	8apn:AJ, 8apo:AJ
4	7pkt:J	114	29	0.0542	0.0789	0.3103	1.8
5	1bmo:A	233	60	0.1205	0.0858	0.3333	5.1	1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A
6	7l08:V	206	37	0.0783	0.0631	0.3514	6.0	7a5f:V3, 7a5g:V3, 7a5h:V, 7a5i:V3, 7a5j:V, 7a5k:V3, 8any:V, 6i9r:V, 3j7y:V, 3j9m:V, 8k2a:LX, 8k2b:LX, 7l20:V, 6nu2:V, 6nu3:V, 7o9k:V, 7o9m:V, 7odr:V, 7ods:V, 7odt:V, 7of2:V, 7of3:V, 7of4:V, 7of5:V, 7of6:V, 7og4:XV, 7oi7:V, 7oi8:V, 7oi9:V, 7oia:V, 7oib:V, 7oic:V, 7oid:V, 7oie:V, 8oir:BC, 8oit:BC, 5ool:V, 5oom:V, 7pd3:V, 8pk0:V, 7po4:V, 7qi4:V, 7qi5:V, 7qi6:V, 8qsj:V, 8qu1:V, 8qu5:V, 6vlz:V, 6vmi:V, 8xt0:LX, 8xt1:LX, 8xt2:LX, 8xt3:LX, 6zm5:V, 6zm6:V, 6zs9:XV, 6zsa:XV, 6zsb:XV, 6zsc:XV, 6zsd:XV, 6zse:XV, 6zsg:XV
7	4nyu:A	406	31	0.0783	0.0320	0.4194	7.6	4ny2:A, 4ny2:B, 4nyy:A, 4nyy:B, 4nyy:C, 4nyy:D, 4nz1:A, 4nz1:B, 4nz3:A, 4nz3:B, 4nz4:A, 4nz4:B, 4oui:A, 4oui:B

[Back]