BioLiP

>protein
YQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLP
ETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQ
IRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMGNITGWRLWLDEPLKVDSLSQQKLPEGSK
WQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIG
AILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALR

The query sequence (length=392) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7v8l:C	396	396	1.0000	0.9899	0.9899	0.0	7arh:C, 7arj:C, 7arl:C, 7arm:C, 7mdx:A
2	7arh:E	409	411	0.2806	0.2689	0.2676	2.29e-36	7arl:E, 7mdx:B, 7v8l:E
3	5lil:A	615	391	0.2041	0.1301	0.2046	0.001	5lil:B, 5lj6:A, 5lj7:B
4	5lj7:A	592	383	0.1964	0.1301	0.2010	0.28
5	8bzx:B	568	160	0.0995	0.0687	0.2437	0.97
6	5ws4:A	650	44	0.0357	0.0215	0.3182	1.8	5ws4:B
7	7w78:B	344	99	0.0689	0.0785	0.2727	1.9	7w7a:B, 7w7a:D, 7w7a:F, 7w7a:H, 7w7b:B, 7w7b:D, 7w7b:F, 7w7b:H, 7w7d:B, 7w7d:D, 7w7d:F, 7w7d:H
8	7oqh:D	364	44	0.0357	0.0385	0.3182	4.0	7oqh:A, 7oqh:B, 7oqh:C, 7oqh:E, 7oqh:F
9	7dic:A	646	47	0.0459	0.0279	0.3830	4.1	7dcy:A, 7did:A, 7dol:A
10	6nts:B	361	71	0.0536	0.0582	0.2958	4.3
11	8jwu:C	412	32	0.0357	0.0340	0.4375	6.3	8jwj:A, 8jwj:C, 8jws:A, 8jws:B, 8jws:C, 8jwu:A, 8jwu:B
12	6zj3:Ln	133	37	0.0255	0.0752	0.2703	7.9
13	7qde:B	169	23	0.0255	0.0592	0.4348	8.5	7qdd:B

[Back]